BLASTX nr result
ID: Glycyrrhiza30_contig00033642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00033642 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH48853.1 hypothetical protein GLYMA_07G117100 [Glycine max] 89 5e-21 KQJ92295.1 hypothetical protein BRADI_4g42726 [Brachypodium dist... 81 2e-17 KQK02644.1 hypothetical protein BRADI_2g02826 [Brachypodium dist... 80 2e-17 KQJ83927.1 hypothetical protein BRADI_5g17605 [Brachypodium dist... 81 2e-17 KQJ92147.1 hypothetical protein BRADI_4g41926 [Brachypodium dist... 81 2e-17 KQK17646.1 hypothetical protein BRADI_1g35855 [Brachypodium dist... 79 5e-17 KQK01221.1 hypothetical protein BRADI_3g54563 [Brachypodium dist... 79 6e-17 KQJ99643.1 hypothetical protein BRADI_3g44466, partial [Brachypo... 79 8e-17 KQK02205.1 hypothetical protein BRADI_3g60991 [Brachypodium dist... 79 1e-16 KQK01677.1 hypothetical protein BRADI_3g57488 [Brachypodium dist... 79 1e-16 KQJ90160.1 hypothetical protein BRADI_4g29800 [Brachypodium dist... 79 1e-16 KQK03206.1 hypothetical protein BRADI_2g06302 [Brachypodium dist... 79 1e-16 KQJ85456.1 hypothetical protein BRADI_5g27156 [Brachypodium dist... 79 1e-16 KQJ92153.1 hypothetical protein BRADI_4g41946 [Brachypodium dist... 79 1e-16 KQJ84088.1 hypothetical protein BRADI_5g18617, partial [Brachypo... 77 5e-16 KQJ82809.1 hypothetical protein BRADI_5g11086 [Brachypodium dist... 77 5e-16 KQK22800.1 hypothetical protein BRADI_1g69441 [Brachypodium dist... 77 7e-16 KQK01789.1 hypothetical protein BRADI_3g58229 [Brachypodium dist... 76 1e-15 KQK23380.1 hypothetical protein BRADI_1g73051, partial [Brachypo... 76 1e-15 KQK02083.1 hypothetical protein BRADI_3g60276, partial [Brachypo... 76 1e-15 >KRH48853.1 hypothetical protein GLYMA_07G117100 [Glycine max] Length = 100 Score = 89.4 bits (220), Expect = 5e-21 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIKM 3 L + YS WKTCIESYLQGQDLWEVVNGNE T P ++ +SL KWRIK+GKAMFVIKM Sbjct: 13 LNYKNYSTWKTCIESYLQGQDLWEVVNGNETTRP-SDAESLTKWRIKSGKAMFVIKM 68 >KQJ92295.1 hypothetical protein BRADI_4g42726 [Brachypodium distachyon] Length = 119 Score = 80.9 bits (198), Expect = 2e-17 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQG DLWEV+ G E TPP N ++LRKWRIK GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGHDLWEVIAGTETTPPE-NAEALRKWRIKVGKAMFVLK 68 >KQK02644.1 hypothetical protein BRADI_2g02826 [Brachypodium distachyon] Length = 106 Score = 80.5 bits (197), Expect = 2e-17 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQG DLWEV+ G E TPP N ++LRKWRIK GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGHDLWEVIAGTETTPPE-NVEALRKWRIKAGKAMFVLK 68 >KQJ83927.1 hypothetical protein BRADI_5g17605 [Brachypodium distachyon] Length = 126 Score = 80.9 bits (198), Expect = 2e-17 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Q Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSQNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQJ92147.1 hypothetical protein BRADI_4g41926 [Brachypodium distachyon] Length = 127 Score = 80.9 bits (198), Expect = 2e-17 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIKM 3 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+KM Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLKM 69 >KQK17646.1 hypothetical protein BRADI_1g35855 [Brachypodium distachyon] Length = 96 Score = 79.0 bits (193), Expect = 5e-17 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQK01221.1 hypothetical protein BRADI_3g54563 [Brachypodium distachyon] Length = 98 Score = 79.0 bits (193), Expect = 6e-17 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQG DLWEV+ G E TPP N ++LRKW IK GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGHDLWEVIAGTETTPPE-NAEALRKWHIKVGKAMFVLK 68 >KQJ99643.1 hypothetical protein BRADI_3g44466, partial [Brachypodium distachyon] Length = 112 Score = 79.0 bits (193), Expect = 8e-17 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQK02205.1 hypothetical protein BRADI_3g60991 [Brachypodium distachyon] Length = 118 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQK01677.1 hypothetical protein BRADI_3g57488 [Brachypodium distachyon] Length = 118 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQJ90160.1 hypothetical protein BRADI_4g29800 [Brachypodium distachyon] Length = 118 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQK03206.1 hypothetical protein BRADI_2g06302 [Brachypodium distachyon] KQK03207.1 hypothetical protein BRADI_2g06304 [Brachypodium distachyon] Length = 126 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQJ85456.1 hypothetical protein BRADI_5g27156 [Brachypodium distachyon] KQK24223.1 hypothetical protein BRADI_1g78809 [Brachypodium distachyon] Length = 126 Score = 79.0 bits (193), Expect = 1e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSGKAMFVLK 68 >KQJ92153.1 hypothetical protein BRADI_4g41946 [Brachypodium distachyon] Length = 119 Score = 78.6 bits (192), Expect = 1e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NVDALRKWKIKSGKAMFVLK 68 >KQJ84088.1 hypothetical protein BRADI_5g18617, partial [Brachypodium distachyon] Length = 112 Score = 77.0 bits (188), Expect = 5e-16 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP + +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-DADALRKWKIKSGKAMFVLK 68 >KQJ82809.1 hypothetical protein BRADI_5g11086 [Brachypodium distachyon] Length = 126 Score = 77.4 bits (189), Expect = 5e-16 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIKM 3 L Y W+TC+ESYLQGQDLWEVV G E P N +LRKW+IK GKAMFV+KM Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPSE-NADALRKWKIKAGKAMFVLKM 69 >KQK22800.1 hypothetical protein BRADI_1g69441 [Brachypodium distachyon] Length = 115 Score = 76.6 bits (187), Expect = 7e-16 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-KADALRKWKIKSGKAMFVLK 68 >KQK01789.1 hypothetical protein BRADI_3g58229 [Brachypodium distachyon] Length = 104 Score = 75.9 bits (185), Expect = 1e-15 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +L KW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALWKWKIKSGKAMFVLK 68 >KQK23380.1 hypothetical protein BRADI_1g73051, partial [Brachypodium distachyon] Length = 112 Score = 75.9 bits (185), Expect = 1e-15 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E P N +LRKW+IK+GKAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPTE-NADALRKWKIKSGKAMFVLK 68 >KQK02083.1 hypothetical protein BRADI_3g60276, partial [Brachypodium distachyon] Length = 112 Score = 75.9 bits (185), Expect = 1e-15 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -2 Query: 173 LGPQKYSMWKTCIESYLQGQDLWEVVNGNEITPPRANPKSLRKWRIKTGKAMFVIK 6 L Y W+TC+ESYLQGQDLWEVV G E PP N +LRKW+IK+ KAMFV+K Sbjct: 14 LNSHNYGYWQTCMESYLQGQDLWEVVAGTEAFPPE-NADALRKWKIKSRKAMFVLK 68