BLASTX nr result
ID: Glycyrrhiza30_contig00033150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00033150 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERF80846.1 hypothetical protein C207_05933 [Bradyrhizobium sp. D... 73 3e-15 WP_024581611.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 72 7e-15 WP_029085462.1 hypothetical protein [Bradyrhizobium sp. th.b2] 49 7e-06 >ERF80846.1 hypothetical protein C207_05933 [Bradyrhizobium sp. DFCI-1] Length = 73 Score = 72.8 bits (177), Expect = 3e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +2 Query: 134 MLGRPDDEEALRLTLAFYCIMEPDKRAIILSLAEQF 241 MLGRPDD+EALRLTLAFYCIMEPDKRAI+LSLAEQF Sbjct: 1 MLGRPDDKEALRLTLAFYCIMEPDKRAIVLSLAEQF 36 >WP_024581611.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU46882.1 hypothetical protein QU41_21105 [Bradyrhizobium elkanii] OCX29726.1 hypothetical protein QU42_18845 [Bradyrhizobium sp. UASWS1016] Length = 73 Score = 71.6 bits (174), Expect = 7e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 134 MLGRPDDEEALRLTLAFYCIMEPDKRAIILSLAEQF 241 MLGRPDDEEALRLTLAFYCIMEPDKRAIIL LAE+F Sbjct: 1 MLGRPDDEEALRLTLAFYCIMEPDKRAIILDLAERF 36 >WP_029085462.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 73 Score = 48.9 bits (115), Expect = 7e-06 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = +2 Query: 134 MLGRPDDEEALRLTLAFYCIMEPDKRAIILSLAEQF 241 ML RP +EEAL+L +AF+ I+EPD+RA +L+LAE++ Sbjct: 1 MLERPSEEEALKLAIAFFWILEPDRRAEVLALAEKY 36