BLASTX nr result
ID: Glycyrrhiza30_contig00033057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00033057 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN39472.1 hypothetical protein glysoja_016859 [Glycine soja] KR... 52 9e-06 >KHN39472.1 hypothetical protein glysoja_016859 [Glycine soja] KRH17321.1 hypothetical protein GLYMA_14G213100 [Glycine max] Length = 177 Score = 51.6 bits (122), Expect = 9e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 303 KKKNMRKGFLLRHGAICGREEDVVDPSRRPIGK 205 KKK +RKGF L HGA+CGREEDVVDP +G+ Sbjct: 140 KKKKVRKGFWLGHGAVCGREEDVVDPGALRVGR 172