BLASTX nr result
ID: Glycyrrhiza30_contig00032939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032939 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP60766.1 Pentatricopeptide repeat-containing protein At1g25360... 111 1e-26 XP_003590744.1 pentatricopeptide (PPR) repeat protein [Medicago ... 109 8e-26 XP_004495263.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 8e-26 XP_014512605.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 2e-25 XP_017434376.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 2e-25 XP_007144135.1 hypothetical protein PHAVU_007G131600g [Phaseolus... 108 2e-25 XP_016176506.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 3e-25 XP_019441088.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 4e-25 XP_003535453.2 PREDICTED: pentatricopeptide repeat-containing pr... 106 7e-25 CBI19832.3 unnamed protein product, partial [Vitis vinifera] 106 7e-25 XP_002280360.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 9e-25 XP_015940905.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 1e-24 KDP46745.1 hypothetical protein JCGZ_06533 [Jatropha curcas] 99 2e-24 KVF06906.1 Pentatricopeptide repeat-containing protein, partial ... 104 3e-24 XP_015884794.1 PREDICTED: pentatricopeptide repeat-containing pr... 104 4e-24 XP_010093155.1 hypothetical protein L484_005164 [Morus notabilis... 104 4e-24 XP_018821025.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 6e-24 XP_004301492.2 PREDICTED: pentatricopeptide repeat-containing pr... 103 1e-23 XP_009378933.2 PREDICTED: pentatricopeptide repeat-containing pr... 102 2e-23 JAU98390.1 Pentatricopeptide repeat-containing protein, partial ... 95 3e-23 >KYP60766.1 Pentatricopeptide repeat-containing protein At1g25360 family [Cajanus cajan] Length = 722 Score = 111 bits (278), Expect = 1e-26 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKFISK+VEREIVVRDRKRFHHFRNGECSCGNYW Sbjct: 673 IRVFKNLRICGDCHNAFKFISKVVEREIVVRDRKRFHHFRNGECSCGNYW 722 >XP_003590744.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES60995.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 795 Score = 109 bits (272), Expect = 8e-26 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFK+ISK+VEREIVVRDRKRFHHF+NGECSCGNYW Sbjct: 746 IRVFKNLRICGDCHNAFKYISKVVEREIVVRDRKRFHHFKNGECSCGNYW 795 >XP_004495263.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] XP_012569722.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] Length = 795 Score = 109 bits (272), Expect = 8e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKFISK+V REIVVRDRKRFHHFRNGECSCGNYW Sbjct: 746 IRVFKNLRICGDCHNAFKFISKVVAREIVVRDRKRFHHFRNGECSCGNYW 795 >XP_014512605.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vigna radiata var. radiata] Length = 787 Score = 108 bits (269), Expect = 2e-25 Identities = 45/50 (90%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCH+AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 738 IRVFKNLRICGDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_017434376.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vigna angularis] KOM52437.1 hypothetical protein LR48_Vigan09g109600 [Vigna angularis] BAT94687.1 hypothetical protein VIGAN_08130900 [Vigna angularis var. angularis] Length = 787 Score = 108 bits (269), Expect = 2e-25 Identities = 45/50 (90%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCH+AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 738 IRVFKNLRICGDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_007144135.1 hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] ESW16129.1 hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] Length = 787 Score = 108 bits (269), Expect = 2e-25 Identities = 45/50 (90%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCH+AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 738 IRVFKNLRICGDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_016176506.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Arachis ipaensis] Length = 789 Score = 107 bits (268), Expect = 3e-25 Identities = 45/50 (90%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKFIS++V+REIVVRDRKRFHHF+NGECSCGNYW Sbjct: 740 IRVFKNLRICGDCHNAFKFISRVVKREIVVRDRKRFHHFKNGECSCGNYW 789 >XP_019441088.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Lupinus angustifolius] Length = 787 Score = 107 bits (267), Expect = 4e-25 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKFIS++V REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 738 IRVFKNLRICGDCHNAFKFISRVVGREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_003535453.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Glycine max] KRH34548.1 hypothetical protein GLYMA_10G190600 [Glycine max] Length = 787 Score = 106 bits (265), Expect = 7e-25 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFK+ISK+V+REI+VRDRKRFHHFRNGECSC NYW Sbjct: 738 IRVFKNLRICGDCHNAFKYISKVVDREIIVRDRKRFHHFRNGECSCSNYW 787 >CBI19832.3 unnamed protein product, partial [Vitis vinifera] Length = 544 Score = 106 bits (264), Expect = 7e-25 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 +RVFKNLR+CGDCHNAFKF+SK+VEREIVVRD KRFHHF+NGECSCGNYW Sbjct: 495 VRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >XP_002280360.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 106 bits (264), Expect = 9e-25 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 +RVFKNLR+CGDCHNAFKF+SK+VEREIVVRD KRFHHF+NGECSCGNYW Sbjct: 750 VRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >XP_015940905.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Arachis duranensis] Length = 789 Score = 105 bits (263), Expect = 1e-24 Identities = 44/50 (88%), Positives = 50/50 (100%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKFIS++V+REIVVRDRKRFHHF+NGECSCG+YW Sbjct: 740 IRVFKNLRICGDCHNAFKFISRVVKREIVVRDRKRFHHFKNGECSCGDYW 789 >KDP46745.1 hypothetical protein JCGZ_06533 [Jatropha curcas] Length = 161 Score = 99.0 bits (245), Expect = 2e-24 Identities = 40/50 (80%), Positives = 48/50 (96%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 +RVFKNLR+CGDCHNAFK++SK+V REIVVRD KRFHHFR+G+CSCG+YW Sbjct: 112 VRVFKNLRICGDCHNAFKYMSKVVSREIVVRDGKRFHHFRDGKCSCGDYW 161 >KVF06906.1 Pentatricopeptide repeat-containing protein, partial [Cynara cardunculus var. scolymus] Length = 817 Score = 104 bits (260), Expect = 3e-24 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKF+S++VEREIVVRD KRFHHFRNG+CSCGNYW Sbjct: 768 IRVFKNLRICGDCHNAFKFMSQVVEREIVVRDGKRFHHFRNGKCSCGNYW 817 >XP_015884794.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Ziziphus jujuba] Length = 800 Score = 104 bits (259), Expect = 4e-24 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKF+SK+VEREI+VRD KRFHHFR GECSCGNYW Sbjct: 751 IRVFKNLRICGDCHNAFKFMSKVVEREIIVRDGKRFHHFRYGECSCGNYW 800 >XP_010093155.1 hypothetical protein L484_005164 [Morus notabilis] EXB53614.1 hypothetical protein L484_005164 [Morus notabilis] Length = 800 Score = 104 bits (259), Expect = 4e-24 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAF F+S++VEREIVVRD KRFHHFRNGECSCGNYW Sbjct: 751 IRVFKNLRICGDCHNAFMFMSRVVEREIVVRDGKRFHHFRNGECSCGNYW 800 >XP_018821025.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Juglans regia] Length = 797 Score = 103 bits (258), Expect = 6e-24 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFK++SK+V REIVVRD KRFHHFRNGECSCGNYW Sbjct: 748 IRVFKNLRICGDCHNAFKYMSKVVGREIVVRDGKRFHHFRNGECSCGNYW 797 >XP_004301492.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Fragaria vesca subsp. vesca] Length = 754 Score = 103 bits (256), Expect = 1e-23 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFK++S++V REIVVRD KRFHHFRNGECSCGNYW Sbjct: 705 IRVFKNLRICGDCHNAFKYMSRVVGREIVVRDAKRFHHFRNGECSCGNYW 754 >XP_009378933.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Pyrus x bretschneideri] Length = 793 Score = 102 bits (255), Expect = 2e-23 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR+CGDCHNAFKFIS++V REI+VRD KRFHHFRNGECSCG+YW Sbjct: 744 IRVFKNLRICGDCHNAFKFISRVVGREIIVRDGKRFHHFRNGECSCGDYW 793 >JAU98390.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 119 Score = 94.7 bits (234), Expect = 3e-23 Identities = 37/50 (74%), Positives = 46/50 (92%) Frame = -1 Query: 281 IRVFKNLRMCGDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 132 IRVFKNLR CGDCHN F+ +S++V+R+I++RDRKRFH FRNGECSCGN+W Sbjct: 70 IRVFKNLRTCGDCHNFFRLLSRVVQRDIILRDRKRFHRFRNGECSCGNFW 119