BLASTX nr result
ID: Glycyrrhiza30_contig00032919
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032919 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024583947.1 MULTISPECIES: LysR family transcriptional regulat... 124 4e-33 SFO51517.1 transcriptional regulator [Variovorax sp. PDC80] 54 8e-07 WP_057595690.1 LysR family transcriptional regulator [Variovorax... 54 8e-07 >WP_024583947.1 MULTISPECIES: LysR family transcriptional regulator [Bradyrhizobium] KIU44235.1 hypothetical protein QU41_32035 [Bradyrhizobium elkanii] OCX27974.1 hypothetical protein QU42_29060 [Bradyrhizobium sp. UASWS1016] Length = 297 Score = 124 bits (311), Expect = 4e-33 Identities = 61/78 (78%), Positives = 69/78 (88%) Frame = -3 Query: 235 REIDIGFVHARPARGEPLRSKLIHGEAFRLAVPRASKFGAAPSARELGKARFIALPGSSA 56 REIDIGF HARP + EP+RSKLI+ EAF+LAVPRASK+GAAPSAREL KA+FIA PGS A Sbjct: 141 REIDIGFAHARPGQDEPVRSKLIYQEAFKLAVPRASKYGAAPSARELSKAKFIAWPGSGA 200 Query: 55 A*GRGELVKACRSAGFEP 2 A GR ELV+ACR+AGFEP Sbjct: 201 AGGRSELVEACRAAGFEP 218 >SFO51517.1 transcriptional regulator [Variovorax sp. PDC80] Length = 295 Score = 54.3 bits (129), Expect = 8e-07 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 3/79 (3%) Frame = -3 Query: 229 IDIGFVH-ARPARGEPLRSKLIHGEAFRLAVP--RASKFGAAPSARELGKARFIALPGSS 59 IDIGF H A PA + L S+ + E + LA+P A G AR L A F+ LP + Sbjct: 143 IDIGFTHRAPPASDDALASRRVAREPYLLALPADHALATGRRAGARALDGAPFVFLPRQA 202 Query: 58 AA*GRGELVKACRSAGFEP 2 GR ++++ACR AGF P Sbjct: 203 TPEGRAQMLEACRRAGFTP 221 >WP_057595690.1 LysR family transcriptional regulator [Variovorax paradoxus] KPU96554.1 hypothetical protein APR52_13520 [Variovorax paradoxus] KPU99358.1 hypothetical protein APR50_33440 [Variovorax paradoxus] KPV00945.1 hypothetical protein APR49_32525 [Variovorax paradoxus] KPV16585.1 hypothetical protein APR51_29975 [Variovorax paradoxus] KPV19457.1 hypothetical protein APR47_40600 [Variovorax paradoxus] KPV26175.1 hypothetical protein APR48_31980 [Variovorax paradoxus] Length = 295 Score = 54.3 bits (129), Expect = 8e-07 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 3/79 (3%) Frame = -3 Query: 229 IDIGFVH-ARPARGEPLRSKLIHGEAFRLAVP--RASKFGAAPSARELGKARFIALPGSS 59 IDIGF H A PA + L S+ + E + LA+P A G AR L A F+ LP + Sbjct: 143 IDIGFAHRAPPASDDALASRRVAREPYLLALPADHALATGRRAGARALDGAPFVFLPRQA 202 Query: 58 AA*GRGELVKACRSAGFEP 2 GR ++++ACR AGF P Sbjct: 203 TPEGRAQMLEACRRAGFTP 221