BLASTX nr result
ID: Glycyrrhiza30_contig00032636
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032636 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_016845706.1 hypothetical protein [Bradyrhizobium elkanii] 59 4e-08 >WP_016845706.1 hypothetical protein [Bradyrhizobium elkanii] Length = 415 Score = 58.9 bits (141), Expect = 4e-08 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 94 MTCNLPHPAMLFESNKNNNPSRPSYSVEGLI 2 M CNLP PA LFESNKNNNPSRPS SVEGLI Sbjct: 1 MACNLPQPATLFESNKNNNPSRPSNSVEGLI 31