BLASTX nr result
ID: Glycyrrhiza30_contig00032455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032455 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003593181.2 replication factor-A carboxy-terminal domain prot... 53 6e-06 XP_013446466.1 replication factor-A carboxy-terminal domain prot... 53 6e-06 >XP_003593181.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES63432.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 555 Score = 52.8 bits (125), Expect = 6e-06 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -2 Query: 203 KIHLQNCIGCTKLIFNPTCEVAVKLKNRFEIVILGP 96 KIH+QNCIGCTK+IF PTC+ AV ++NR + P Sbjct: 216 KIHVQNCIGCTKVIFKPTCDAAVSMRNRLSETVDTP 251 >XP_013446466.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] KEH20493.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 555 Score = 52.8 bits (125), Expect = 6e-06 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -2 Query: 203 KIHLQNCIGCTKLIFNPTCEVAVKLKNRFEIVILGP 96 KIH+QNCIGCTK+IF PTC+ AV ++NR + P Sbjct: 216 KIHVQNCIGCTKVIFKPTCDAAVSMRNRLSETVDTP 251