BLASTX nr result
ID: Glycyrrhiza30_contig00032432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032432 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004508660.1 PREDICTED: uncharacterized protein C13E7.11 [Cice... 57 8e-08 >XP_004508660.1 PREDICTED: uncharacterized protein C13E7.11 [Cicer arietinum] Length = 325 Score = 57.0 bits (136), Expect = 8e-08 Identities = 30/67 (44%), Positives = 42/67 (62%) Frame = +3 Query: 6 TEGGRVINPSKELVLGASGALIGILMADYYLFGEAYAHFPPTFKAVPLALGIFAIEKWML 185 ++G R INPSKEL LGASGA+ I++ D +L+ A +F LGIF I K ML Sbjct: 233 SKGWRAINPSKELALGASGAVNAIMLLDIFLYPRATLYFYFVIPVPAALLGIFLIGKDML 292 Query: 186 SVMKGDT 206 +++GD+ Sbjct: 293 RIIEGDS 299