BLASTX nr result
ID: Glycyrrhiza30_contig00032408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032408 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003596628.1 F-box/LRR protein [Medicago truncatula] AES66879.... 83 4e-18 XP_003596625.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 86 2e-17 XP_013470418.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 83 3e-16 KYP39139.1 F-box/LRR-repeat protein At3g14710 family [Cajanus ca... 81 2e-15 XP_013470417.1 F-box/RNI superfamily protein [Medicago truncatul... 79 4e-15 GAU12185.1 hypothetical protein TSUD_01520 [Trifolium subterraneum] 77 3e-14 KYP39134.1 F-box/FBD/LRR-repeat protein At4g26340 family [Cajanu... 77 4e-14 XP_003596627.2 F-box/RNI superfamily protein [Medicago truncatul... 76 8e-14 KHN26285.1 Putative FBD-associated F-box protein [Glycine soja] 75 2e-13 KRH04905.1 hypothetical protein GLYMA_17G194900 [Glycine max] 75 2e-13 XP_014625143.1 PREDICTED: F-box/LRR-repeat protein At3g58900-lik... 75 3e-13 XP_006601071.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g14710... 75 3e-13 XP_013449654.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 74 5e-13 XP_004515583.1 PREDICTED: FBD-associated F-box protein At4g10400... 74 7e-13 KNA23560.1 hypothetical protein SOVF_023670 [Spinacia oleracea] 72 3e-12 XP_007149439.1 hypothetical protein PHAVU_005G0705001g, partial ... 71 6e-12 XP_014621768.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g14710... 70 8e-12 KRH21848.1 hypothetical protein GLYMA_13G262900 [Glycine max] 70 1e-11 XP_004488685.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340... 70 1e-11 XP_017220872.1 PREDICTED: F-box/LRR-repeat protein At4g14103-lik... 70 1e-11 >XP_003596628.1 F-box/LRR protein [Medicago truncatula] AES66879.1 F-box/LRR protein [Medicago truncatula] Length = 123 Score = 83.2 bits (204), Expect = 4e-18 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +2 Query: 215 KKNKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 +K+K SKR +GQD++SNLPD IIG+IL FLPTK AVRTSVLSK+W YLW FIT Sbjct: 12 RKHKLSKRQNSIKGQDLISNLPDHIIGYILFFLPTKEAVRTSVLSKKWIYLWKFIT 67 >XP_003596625.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] AES66876.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 411 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = +2 Query: 218 KNKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 K+K SKR K ++GQD++SNLPD IIG +LSFLPTK AV TSVLSKRW YLWTFIT Sbjct: 13 KHKLSKRQKSNKGQDLISNLPDHIIGCVLSFLPTKDAVSTSVLSKRWIYLWTFIT 67 >XP_013470418.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH44456.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 442 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/65 (58%), Positives = 47/65 (72%) Frame = +2 Query: 188 ISMESCSVSKKNKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYL 367 I+ S + + KRHK SEGQD++S+LPDF+IG ILSFLPTK AVRT LS+RW Y Sbjct: 8 IACTSAAAAAGRHDKKRHKSSEGQDMISDLPDFVIGRILSFLPTKYAVRTGALSQRWIYK 67 Query: 368 WTFIT 382 W F+T Sbjct: 68 WMFLT 72 >KYP39139.1 F-box/LRR-repeat protein At3g14710 family [Cajanus cajan] Length = 396 Score = 80.9 bits (198), Expect = 2e-15 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +2 Query: 221 NKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 N SK+ K E QDI+SNLPD II +ILSFLPT+ AVRT VLSKRW YLWTFIT Sbjct: 4 NSSSKKQKSKEDQDIISNLPDVIIYYILSFLPTRDAVRTCVLSKRWIYLWTFIT 57 >XP_013470417.1 F-box/RNI superfamily protein [Medicago truncatula] KEH44455.1 F-box/RNI superfamily protein [Medicago truncatula] Length = 308 Score = 79.3 bits (194), Expect = 4e-15 Identities = 40/65 (61%), Positives = 46/65 (70%), Gaps = 2/65 (3%) Frame = +2 Query: 194 MESCSVSKKNKR--SKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYL 367 M S S S+ + KR K SEGQDI+S L D II HILSFLPT AVRTS LS+RW Y+ Sbjct: 2 MHSASTSEAAAQPWKKRQKSSEGQDIISRLSDCIIAHILSFLPTNYAVRTSALSQRWRYM 61 Query: 368 WTFIT 382 WTF+T Sbjct: 62 WTFVT 66 >GAU12185.1 hypothetical protein TSUD_01520 [Trifolium subterraneum] Length = 387 Score = 77.4 bits (189), Expect = 3e-14 Identities = 38/66 (57%), Positives = 51/66 (77%), Gaps = 2/66 (3%) Frame = +2 Query: 191 SMESCSVSKKN--KRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTY 364 S+ +C+ + ++ + SKR K SE +D +SNLPDFIIGHIL+FL K A++TSVLS RW Y Sbjct: 5 SVTACTSAGRHDTEPSKRQKFSEDEDRISNLPDFIIGHILTFLDNKNAIKTSVLSWRWRY 64 Query: 365 LWTFIT 382 +WTFIT Sbjct: 65 MWTFIT 70 >KYP39134.1 F-box/FBD/LRR-repeat protein At4g26340 family [Cajanus cajan] Length = 382 Score = 77.0 bits (188), Expect = 4e-14 Identities = 38/54 (70%), Positives = 41/54 (75%) Frame = +2 Query: 221 NKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 N SK+ K +E DI+SNLPD IIG ILSFL TK AV T VLSKRW YLWTFIT Sbjct: 4 NSPSKKQKSNEDHDIISNLPDVIIGRILSFLLTKEAVSTCVLSKRWIYLWTFIT 57 >XP_003596627.2 F-box/RNI superfamily protein [Medicago truncatula] AES66878.2 F-box/RNI superfamily protein [Medicago truncatula] Length = 374 Score = 76.3 bits (186), Expect = 8e-14 Identities = 41/64 (64%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = +2 Query: 194 MESCSVSKKNKRSKRHK-PSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLW 370 M S SV ++R +HK S+GQD++SNLPD IIG+IL FL TK AVRTSVLSK+W YLW Sbjct: 1 MASSSVDAIDRR--KHKLSSKGQDLISNLPDHIIGYILYFLSTKEAVRTSVLSKKWIYLW 58 Query: 371 TFIT 382 FIT Sbjct: 59 KFIT 62 >KHN26285.1 Putative FBD-associated F-box protein [Glycine soja] Length = 409 Score = 75.1 bits (183), Expect = 2e-13 Identities = 39/52 (75%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 230 SKRHKPS-EGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 +KR KP+ EGQD +SNLPDFIIG ILS LPTK A RTSVLSKRW LW FIT Sbjct: 10 NKRLKPNPEGQDFISNLPDFIIGLILSLLPTKDAFRTSVLSKRWINLWMFIT 61 >KRH04905.1 hypothetical protein GLYMA_17G194900 [Glycine max] Length = 423 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = +2 Query: 206 SVSKKNKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 S ++K KRHK +EG+ +S LP+ ++ HILSFLPTK AVRTSVLSK+W + WTFIT Sbjct: 12 SSTRKQNLLKRHKINEGEGTLSKLPEPLVSHILSFLPTKDAVRTSVLSKKWQFRWTFIT 70 >XP_014625143.1 PREDICTED: F-box/LRR-repeat protein At3g58900-like [Glycine max] KRH04884.1 hypothetical protein GLYMA_17G193700 [Glycine max] Length = 452 Score = 75.1 bits (183), Expect = 3e-13 Identities = 39/52 (75%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 230 SKRHKPS-EGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 +KR KP+ EGQD +SNLPDFIIG ILS LPTK A RTSVLSKRW LW FIT Sbjct: 10 NKRLKPNPEGQDFISNLPDFIIGLILSLLPTKDAFRTSVLSKRWINLWMFIT 61 >XP_006601071.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g14710-like [Glycine max] Length = 468 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = +2 Query: 206 SVSKKNKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 S ++K KRHK +EG+ +S LP+ ++ HILSFLPTK AVRTSVLSK+W + WTFIT Sbjct: 12 SSTRKQNLLKRHKINEGEGTLSKLPEPLVSHILSFLPTKDAVRTSVLSKKWQFRWTFIT 70 >XP_013449654.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH23682.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 470 Score = 74.3 bits (181), Expect = 5e-13 Identities = 40/68 (58%), Positives = 50/68 (73%), Gaps = 5/68 (7%) Frame = +2 Query: 194 MESCSVSK----KNKRSKRHK-PSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRW 358 M SC ++ +N+ SKR + S GQDI+SNLP FII HILSFL + AVRTSVLS+RW Sbjct: 1 MNSCLLTASDRHENEPSKRMQISSAGQDIISNLPVFIIAHILSFLRIEDAVRTSVLSRRW 60 Query: 359 TYLWTFIT 382 Y+WTF+T Sbjct: 61 IYMWTFVT 68 >XP_004515583.1 PREDICTED: FBD-associated F-box protein At4g10400-like [Cicer arietinum] Length = 458 Score = 73.9 bits (180), Expect = 7e-13 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 221 NKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 N+ KRH EG D++SNLP+ +IGHILSFL TK A+ TSVLSKRW Y+WT +T Sbjct: 8 NETPKRH--DEGDDMISNLPEPVIGHILSFLSTKQAIATSVLSKRWKYIWTLVT 59 >KNA23560.1 hypothetical protein SOVF_023670 [Spinacia oleracea] Length = 458 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +2 Query: 233 KRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLW 370 KR KP E DI+SNLPD II HI+SFLPT+ A+RTS+LS RW YLW Sbjct: 2 KREKPVEELDIISNLPDHIIAHIISFLPTEEAIRTSILSSRWKYLW 47 >XP_007149439.1 hypothetical protein PHAVU_005G0705001g, partial [Phaseolus vulgaris] ESW21433.1 hypothetical protein PHAVU_005G0705001g, partial [Phaseolus vulgaris] Length = 451 Score = 71.2 bits (173), Expect = 6e-12 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +2 Query: 230 SKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 ++++ EGQDI+S LPDFIIG ILSFLPTK AVRT VLS RW Y W IT Sbjct: 9 NRQNSSGEGQDIISYLPDFIIGQILSFLPTKHAVRTCVLSTRWIYRWRSIT 59 >XP_014621768.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g14710-like [Glycine max] Length = 330 Score = 70.5 bits (171), Expect = 8e-12 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +2 Query: 230 SKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 + R EGQDI S+LPD IIG ILS LPTK AVRTS+LSKRW LW F+T Sbjct: 7 TSRESNYEGQDIFSDLPDVIIGRILSILPTKEAVRTSILSKRWRNLWKFVT 57 >KRH21848.1 hypothetical protein GLYMA_13G262900 [Glycine max] Length = 447 Score = 70.5 bits (171), Expect = 1e-11 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +2 Query: 230 SKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 + R EGQDI S+LPD IIG ILS LPTK AVRTS+LSKRW LW F+T Sbjct: 7 TSRESNYEGQDIFSDLPDVIIGRILSILPTKEAVRTSILSKRWRNLWKFVT 57 >XP_004488685.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340-like [Cicer arietinum] Length = 451 Score = 70.5 bits (171), Expect = 1e-11 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +2 Query: 230 SKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFIT 382 SK + + +DI+S+LPD+IIG ILSFLPTK AVRTSVLSKRW LW F+T Sbjct: 17 SKWERFDKREDIISDLPDYIIGSILSFLPTKDAVRTSVLSKRWKNLWKFVT 67 >XP_017220872.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like [Daucus carota subsp. sativus] XP_017220873.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like [Daucus carota subsp. sativus] Length = 499 Score = 70.5 bits (171), Expect = 1e-11 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = +2 Query: 206 SVSKKNKRSKRHKPSEGQDIVSNLPDFIIGHILSFLPTKLAVRTSVLSKRWTYLWTFI 379 +V+K+ + S+ QD++SNLPD +I HILSFLPTK AV T++LSKRW YLWT + Sbjct: 8 TVTKRPRFSEDVSRCNNQDMISNLPDALISHILSFLPTKYAVGTTILSKRWNYLWTSV 65