BLASTX nr result
ID: Glycyrrhiza30_contig00032361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032361 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCD99583.1 hypothetical protein BRAS3809_2780020 [Bradyrhizobium... 75 1e-16 EAQ34304.1 resolvase [Nitrobacter sp. Nb-311A] 69 6e-12 BAV47836.1 Uncharacterized protein MLTONO_2933 [Mesorhizobium loti] 56 6e-09 KDM66641.1 integrase [Acidiphilium sp. JA12-A1] 53 2e-06 SBT05279.1 hypothetical protein ACCAA_200053 [Candidatus Accumul... 49 5e-06 CCD99584.1 hypothetical protein BRAS3809_2780021 [Bradyrhizobium... 47 7e-06 >CCD99583.1 hypothetical protein BRAS3809_2780020 [Bradyrhizobium sp. STM 3809] Length = 64 Score = 75.5 bits (184), Expect = 1e-16 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -1 Query: 200 RREWDSNPRYGFPHTRFPSVRLKPLGHLSGRPSLEG 93 RREWDSNPRYGFPHTRFPSVRLKPLGHLSG P L G Sbjct: 10 RREWDSNPRYGFPHTRFPSVRLKPLGHLSGGPLLAG 45 >EAQ34304.1 resolvase [Nitrobacter sp. Nb-311A] Length = 603 Score = 68.6 bits (166), Expect = 6e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 200 RREWDSNPRYGFPHTRFPSVRLKPLGHLS 114 RREWDSNPRYGFPHTRFPSVRLKPLGHLS Sbjct: 548 RREWDSNPRYGFPHTRFPSVRLKPLGHLS 576 >BAV47836.1 Uncharacterized protein MLTONO_2933 [Mesorhizobium loti] Length = 65 Score = 55.8 bits (133), Expect = 6e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +3 Query: 114 GEMAEWLKAHAWKACVRETVPWVRIPLSP 200 GE+AEWLKAHAWK C+RETV VRIPLSP Sbjct: 34 GEVAEWLKAHAWKVCLRETVTRVRIPLSP 62 >KDM66641.1 integrase [Acidiphilium sp. JA12-A1] Length = 591 Score = 52.8 bits (125), Expect = 2e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 120 MAEWLKAHAWKACVRETVPWVRIPLSP 200 MAE KAHAWKACVRE VPWVRIPL P Sbjct: 1 MAERSKAHAWKACVRENVPWVRIPLPP 27 >SBT05279.1 hypothetical protein ACCAA_200053 [Candidatus Accumulibacter aalborgensis] Length = 72 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 199 GESGIRTHGTVSRTHAFQACALSHSAISP 113 GESGIRT G ++ THAFQAC L+HS+ISP Sbjct: 39 GESGIRTRGRIAPTHAFQACDLNHSSISP 67 >CCD99584.1 hypothetical protein BRAS3809_2780021 [Bradyrhizobium sp. STM 3809] Length = 34 Score = 47.4 bits (111), Expect = 7e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 198 ERVGFEPTVRFPAHTLSKRAP 136 ERVGFEPTVRFPAHTLSKRAP Sbjct: 14 ERVGFEPTVRFPAHTLSKRAP 34