BLASTX nr result
ID: Glycyrrhiza30_contig00032356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032356 (581 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007131999.1 hypothetical protein PHAVU_011G058200g [Phaseolus... 53 8e-06 >XP_007131999.1 hypothetical protein PHAVU_011G058200g [Phaseolus vulgaris] ESW03993.1 hypothetical protein PHAVU_011G058200g [Phaseolus vulgaris] Length = 108 Score = 52.8 bits (125), Expect = 8e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -1 Query: 419 RTQDGEFVQAAPAPSPSPTMDAGAAFLVTYSGAFVC 312 R Q EF QA P+P+PTMDAGA FLVTYSGAFVC Sbjct: 63 RAQTSEFPQA---PAPAPTMDAGAGFLVTYSGAFVC 95