BLASTX nr result
ID: Glycyrrhiza30_contig00032192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032192 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAZ32886.1 putative origin recognition complex subunit 6-contain... 53 2e-06 >AAZ32886.1 putative origin recognition complex subunit 6-containing protein [Medicago sativa] Length = 107 Score = 53.1 bits (126), Expect = 2e-06 Identities = 29/54 (53%), Positives = 33/54 (61%) Frame = +2 Query: 182 FGATKERKNPKEVKTSRSISFSHSVVCISAYLLH*LPNKRTPEDGGYLSDDGLE 343 FG KE+K+PKEVKT+R LL LP+KR EDGGYLSDDG E Sbjct: 9 FGVAKEKKDPKEVKTNRD-------------LLDVLPSKRKAEDGGYLSDDGAE 49