BLASTX nr result
ID: Glycyrrhiza30_contig00032142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00032142 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019459759.1 PREDICTED: type IV inositol polyphosphate 5-phosp... 54 1e-06 XP_006576610.2 PREDICTED: type IV inositol polyphosphate 5-phosp... 52 4e-06 KHN15585.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP... 52 4e-06 XP_006576609.2 PREDICTED: type IV inositol polyphosphate 5-phosp... 52 4e-06 >XP_019459759.1 PREDICTED: type IV inositol polyphosphate 5-phosphatase 9-like [Lupinus angustifolius] Length = 444 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 228 LSERFGQIKTHFEVSPTHEFICNKQSSFR 142 +SERFGQ+KTHF+VSPT EFIC QSSFR Sbjct: 415 MSERFGQLKTHFDVSPTDEFICKNQSSFR 443 >XP_006576610.2 PREDICTED: type IV inositol polyphosphate 5-phosphatase 9-like isoform X2 [Glycine max] KRH66073.1 hypothetical protein GLYMA_03G081200 [Glycine max] Length = 450 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 228 LSERFGQIKTHFEVSPTHEFICNKQSSFRL 139 LSERF QI+T FEVSPT+EF+C KQSSFRL Sbjct: 421 LSERFEQIETPFEVSPTYEFVCKKQSSFRL 450 >KHN15585.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 [Glycine soja] Length = 454 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 228 LSERFGQIKTHFEVSPTHEFICNKQSSFRL 139 LSERF QI+T FEVSPT+EF+C KQSSFRL Sbjct: 425 LSERFEQIETPFEVSPTYEFVCKKQSSFRL 454 >XP_006576609.2 PREDICTED: type IV inositol polyphosphate 5-phosphatase 9-like isoform X1 [Glycine max] Length = 473 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 228 LSERFGQIKTHFEVSPTHEFICNKQSSFRL 139 LSERF QI+T FEVSPT+EF+C KQSSFRL Sbjct: 444 LSERFEQIETPFEVSPTYEFVCKKQSSFRL 473