BLASTX nr result
ID: Glycyrrhiza30_contig00031931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00031931 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV73622.1 UBN2 domain-containing protein [Cephalotus follicularis] 42 5e-06 >GAV73622.1 UBN2 domain-containing protein [Cephalotus follicularis] Length = 203 Score = 42.0 bits (97), Expect(2) = 5e-06 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 Query: 246 FKMHDHKTIDQMFSRFQTIINGLRALRRT*PQLRLCKK 133 F MHDH+ I MF+RF TIIN L+ L ++ P L +K Sbjct: 107 FMMHDHENISYMFTRFTTIINSLKNLGKSYPNQELVRK 144 Score = 35.4 bits (80), Expect(2) = 5e-06 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -3 Query: 152 N*DYVRKIIKSLFKQWRSKVFDIEEVKDFATI 57 N + VRKI++ L K W KV IEE KD +T+ Sbjct: 138 NQELVRKILRCLLKSWTPKVTAIEEAKDLSTL 169