BLASTX nr result
ID: Glycyrrhiza30_contig00031850
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00031850 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW10507.1 hypothetical protein TanjilG_15879 [Lupinus angustifo... 89 2e-19 OIV94554.1 hypothetical protein TanjilG_25616 [Lupinus angustifo... 89 2e-19 XP_019445546.1 PREDICTED: tobamovirus multiplication protein 1-l... 89 2e-19 XP_019422206.1 PREDICTED: tobamovirus multiplication protein 1-l... 89 2e-19 KRH58269.1 hypothetical protein GLYMA_05G116900 [Glycine max] 87 4e-19 OIV93115.1 hypothetical protein TanjilG_20777 [Lupinus angustifo... 88 7e-19 KHN42747.1 hypothetical protein glysoja_030230 [Glycine soja] 87 7e-19 XP_003524734.1 PREDICTED: tobamovirus multiplication protein 1-l... 87 1e-18 XP_016190637.1 PREDICTED: tobamovirus multiplication protein 1-l... 87 1e-18 KRH58267.1 hypothetical protein GLYMA_05G116900 [Glycine max] 87 1e-18 XP_015957578.1 PREDICTED: tobamovirus multiplication protein 1-l... 87 1e-18 KHN39229.1 hypothetical protein glysoja_028034 [Glycine soja] 87 1e-18 XP_019423189.1 PREDICTED: tobamovirus multiplication protein 1-l... 88 1e-18 XP_014515696.1 PREDICTED: tobamovirus multiplication protein 1-l... 86 1e-18 XP_017408046.1 PREDICTED: tobamovirus multiplication protein 1-l... 86 2e-18 KYP61151.1 hypothetical protein KK1_023576 [Cajanus cajan] 87 2e-18 KRH42146.1 hypothetical protein GLYMA_08G072000 [Glycine max] 87 2e-18 XP_003531031.1 PREDICTED: tobamovirus multiplication protein 1 i... 87 2e-18 XP_017408045.1 PREDICTED: tobamovirus multiplication protein 1-l... 86 2e-18 XP_017408044.1 PREDICTED: tobamovirus multiplication protein 1-l... 86 2e-18 >OIW10507.1 hypothetical protein TanjilG_15879 [Lupinus angustifolius] Length = 266 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 224 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 266 >OIV94554.1 hypothetical protein TanjilG_25616 [Lupinus angustifolius] Length = 266 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 224 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 266 >XP_019445546.1 PREDICTED: tobamovirus multiplication protein 1-like [Lupinus angustifolius] Length = 290 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 248 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 290 >XP_019422206.1 PREDICTED: tobamovirus multiplication protein 1-like [Lupinus angustifolius] Length = 290 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 248 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 290 >KRH58269.1 hypothetical protein GLYMA_05G116900 [Glycine max] Length = 241 Score = 87.4 bits (215), Expect = 4e-19 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPS LVLFILRKLPPRRVSDQYHPIR Sbjct: 199 VLDHPILNLVYYLLVEIVPSTLVLFILRKLPPRRVSDQYHPIR 241 >OIV93115.1 hypothetical protein TanjilG_20777 [Lupinus angustifolius] Length = 289 Score = 87.8 bits (216), Expect = 7e-19 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILN+VYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 247 VLDHPILNVVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 289 >KHN42747.1 hypothetical protein glysoja_030230 [Glycine soja] Length = 268 Score = 87.4 bits (215), Expect = 7e-19 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPS LVLFILRKLPPRRVSDQYHPIR Sbjct: 226 VLDHPILNLVYYLLVEIVPSTLVLFILRKLPPRRVSDQYHPIR 268 >XP_003524734.1 PREDICTED: tobamovirus multiplication protein 1-like isoform X1 [Glycine max] KRH58268.1 hypothetical protein GLYMA_05G116900 [Glycine max] Length = 293 Score = 87.4 bits (215), Expect = 1e-18 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPS LVLFILRKLPPRRVSDQYHPIR Sbjct: 251 VLDHPILNLVYYLLVEIVPSTLVLFILRKLPPRRVSDQYHPIR 293 >XP_016190637.1 PREDICTED: tobamovirus multiplication protein 1-like [Arachis ipaensis] Length = 278 Score = 87.0 bits (214), Expect = 1e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNL+YYLLVEIVPS LVLFILRKLPPRRVSDQYHPIR Sbjct: 236 VLDHPILNLIYYLLVEIVPSGLVLFILRKLPPRRVSDQYHPIR 278 >KRH58267.1 hypothetical protein GLYMA_05G116900 [Glycine max] Length = 304 Score = 87.4 bits (215), Expect = 1e-18 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNLVYYLLVEIVPS LVLFILRKLPPRRVSDQYHPIR Sbjct: 262 VLDHPILNLVYYLLVEIVPSTLVLFILRKLPPRRVSDQYHPIR 304 >XP_015957578.1 PREDICTED: tobamovirus multiplication protein 1-like [Arachis duranensis] Length = 293 Score = 87.0 bits (214), Expect = 1e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNL+YYLLVEIVPS LVLFILRKLPPRRVSDQYHPIR Sbjct: 251 VLDHPILNLIYYLLVEIVPSGLVLFILRKLPPRRVSDQYHPIR 293 >KHN39229.1 hypothetical protein glysoja_028034 [Glycine soja] Length = 270 Score = 86.7 bits (213), Expect = 1e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNL+YYLLVEIVPSALVLFILRKLPPRRVSDQYHPI+ Sbjct: 228 VLDHPILNLMYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIK 270 >XP_019423189.1 PREDICTED: tobamovirus multiplication protein 1-like isoform X1 [Lupinus angustifolius] Length = 358 Score = 87.8 bits (216), Expect = 1e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILN+VYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 316 VLDHPILNVVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 358 >XP_014515696.1 PREDICTED: tobamovirus multiplication protein 1-like isoform X2 [Vigna radiata var. radiata] Length = 253 Score = 86.3 bits (212), Expect = 1e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VL+HPILNLVYYL+VEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 211 VLNHPILNLVYYLMVEIVPSALVLFILRKLPPRRVSDQYHPIR 253 >XP_017408046.1 PREDICTED: tobamovirus multiplication protein 1-like isoform X4 [Vigna angularis] BAT73960.1 hypothetical protein VIGAN_01153700 [Vigna angularis var. angularis] Length = 258 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VL+HPILNLVYYL+VEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 216 VLNHPILNLVYYLMVEIVPSALVLFILRKLPPRRVSDQYHPIR 258 >KYP61151.1 hypothetical protein KK1_023576 [Cajanus cajan] Length = 311 Score = 87.0 bits (214), Expect = 2e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VL+HPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 269 VLNHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 311 >KRH42146.1 hypothetical protein GLYMA_08G072000 [Glycine max] Length = 289 Score = 86.7 bits (213), Expect = 2e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNL+YYLLVEIVPSALVLFILRKLPPRRVSDQYHPI+ Sbjct: 247 VLDHPILNLMYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIK 289 >XP_003531031.1 PREDICTED: tobamovirus multiplication protein 1 isoform X1 [Glycine max] KRH42148.1 hypothetical protein GLYMA_08G072000 [Glycine max] Length = 294 Score = 86.7 bits (213), Expect = 2e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VLDHPILNL+YYLLVEIVPSALVLFILRKLPPRRVSDQYHPI+ Sbjct: 252 VLDHPILNLMYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIK 294 >XP_017408045.1 PREDICTED: tobamovirus multiplication protein 1-like isoform X3 [Vigna angularis] KOM27709.1 hypothetical protein LR48_Vigan452s000800 [Vigna angularis] Length = 282 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VL+HPILNLVYYL+VEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 240 VLNHPILNLVYYLMVEIVPSALVLFILRKLPPRRVSDQYHPIR 282 >XP_017408044.1 PREDICTED: tobamovirus multiplication protein 1-like isoform X2 [Vigna angularis] Length = 285 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -2 Query: 287 VLDHPILNLVYYLLVEIVPSALVLFILRKLPPRRVSDQYHPIR 159 VL+HPILNLVYYL+VEIVPSALVLFILRKLPPRRVSDQYHPIR Sbjct: 243 VLNHPILNLVYYLMVEIVPSALVLFILRKLPPRRVSDQYHPIR 285