BLASTX nr result
ID: Glycyrrhiza30_contig00031666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00031666 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_006023170.1 MULTISPECIES: hypothetical protein [Rhizobiales] ... 76 1e-15 >WP_006023170.1 MULTISPECIES: hypothetical protein [Rhizobiales] ABS65517.1 hypothetical protein Xaut_0259 [Xanthobacter autotrophicus Py2] ABS67909.1 hypothetical protein Xaut_2668 [Xanthobacter autotrophicus Py2] EKS34559.1 hypothetical protein HMPREF9695_04469 [Afipia broomeae ATCC 49717] Length = 155 Score = 76.3 bits (186), Expect = 1e-15 Identities = 39/63 (61%), Positives = 39/63 (61%) Frame = +2 Query: 83 MATIALXXXXXXXXXXXXXXSVGTPEYAKTDPTPYLLPATRVHXXXXXXXXXXYAWLGVA 262 MATIAL SVGTPEYAKTDPTPYLLPATRVH YAWLGVA Sbjct: 1 MATIALRTTTTFPAETPRTASVGTPEYAKTDPTPYLLPATRVHPIAIAIPLLAYAWLGVA 60 Query: 263 AWL 271 AWL Sbjct: 61 AWL 63