BLASTX nr result
ID: Glycyrrhiza30_contig00031316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00031316 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003620206.2 NB-ARC domain protein [Medicago truncatula] AES76... 57 2e-07 >XP_003620206.2 NB-ARC domain protein [Medicago truncatula] AES76424.2 NB-ARC domain protein [Medicago truncatula] Length = 583 Score = 57.4 bits (137), Expect = 2e-07 Identities = 37/96 (38%), Positives = 51/96 (53%), Gaps = 2/96 (2%) Frame = -1 Query: 305 RISIVVFTDNYDVSSLRLEVLAYIFDYFGQND--RLVFPVYYANRFDAYHGIISRCKPFN 132 RI+I+VF+DNY S LE LA+I D F Q+D R + PVYY +A H + + PF Sbjct: 68 RIAIIVFSDNYAGSKFLLEELAFIVDNFQQSDNLRFIVPVYY--NIEASH-VRHQSGPFE 124 Query: 131 IPYFLPSKSRKKLFEKVEKMSNALRRVREMSGWDLD 24 + + + EKV K AL +V + GW D Sbjct: 125 AAFVKHEERFHENREKVLKWKTALSQVANLPGWHFD 160