BLASTX nr result
ID: Glycyrrhiza30_contig00031301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00031301 (235 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN47076.1 Pentatricopeptide repeat-containing protein [Glycine ... 90 2e-19 XP_003522599.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 2e-19 OIV90207.1 hypothetical protein TanjilG_01403 [Lupinus angustifo... 90 3e-19 XP_019429066.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 3e-19 XP_004505733.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 8e-19 BAU00443.1 hypothetical protein VIGAN_10204100 [Vigna angularis ... 88 1e-18 XP_014521157.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 1e-18 XP_017426186.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 1e-18 XP_007157299.1 hypothetical protein PHAVU_002G058400g [Phaseolus... 88 1e-18 XP_003607207.1 PPR containing plant-like protein [Medicago trunc... 86 1e-17 XP_003609024.1 PPR containing plant-like protein [Medicago trunc... 86 1e-17 ONI03928.1 hypothetical protein PRUPE_6G292100 [Prunus persica] 78 5e-15 XP_008245013.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 2e-14 GAU36942.1 hypothetical protein TSUD_62110 [Trifolium subterraneum] 74 1e-13 XP_018828577.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 2e-13 GAV77181.1 PPR domain-containing protein/PPR_2 domain-containing... 72 5e-13 XP_004305084.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 4e-12 XP_015897390.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 7e-12 KCW53921.1 hypothetical protein EUGRSUZ_J03132 [Eucalyptus grandis] 68 1e-11 XP_010034051.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 1e-11 >KHN47076.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 469 Score = 90.1 bits (222), Expect = 2e-19 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 FQQ+AK LT GDYVLLSNIYAEAERW EVER+RSEM+ LHVPKQ YSQIDM Sbjct: 409 FQQLAKLGRLTDGDYVLLSNIYAEAERWDEVERVRSEMIGLHVPKQVAYSQIDM 462 >XP_003522599.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Glycine max] KRH64793.1 hypothetical protein GLYMA_04G255300 [Glycine max] Length = 535 Score = 90.1 bits (222), Expect = 2e-19 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 FQQ+AK LT GDYVLLSNIYAEAERW EVER+RSEM+ LHVPKQ YSQIDM Sbjct: 475 FQQLAKLGRLTDGDYVLLSNIYAEAERWDEVERVRSEMIGLHVPKQVAYSQIDM 528 >OIV90207.1 hypothetical protein TanjilG_01403 [Lupinus angustifolius] Length = 485 Score = 89.7 bits (221), Expect = 3e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 FQQ+AK +HLT GDYVLLSNIYAEA+RW EVER+RSEMV L+ KQAGYSQID+ Sbjct: 425 FQQLAKLQHLTDGDYVLLSNIYAEAKRWNEVERVRSEMVSLYATKQAGYSQIDV 478 >XP_019429066.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Lupinus angustifolius] Length = 540 Score = 89.7 bits (221), Expect = 3e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 FQQ+AK +HLT GDYVLLSNIYAEA+RW EVER+RSEMV L+ KQAGYSQID+ Sbjct: 480 FQQLAKLQHLTDGDYVLLSNIYAEAKRWNEVERVRSEMVSLYATKQAGYSQIDV 533 >XP_004505733.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cicer arietinum] Length = 544 Score = 88.6 bits (218), Expect = 8e-19 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 FQQ+AKFE LT GDYVLLSNIYAEA RW EVERLR+EM L+VPK+AGYSQIDM Sbjct: 484 FQQLAKFEQLTIGDYVLLSNIYAEAGRWDEVERLRNEMDYLNVPKEAGYSQIDM 537 >BAU00443.1 hypothetical protein VIGAN_10204100 [Vigna angularis var. angularis] Length = 530 Score = 87.8 bits (216), Expect = 1e-18 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 F Q+AK + L+ GDYVLLSNIYAEAERW EVERLRSEM+DLHV KQ G+SQIDM Sbjct: 474 FLQLAKLKSLSDGDYVLLSNIYAEAERWDEVERLRSEMIDLHVSKQVGHSQIDM 527 >XP_014521157.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Vigna radiata var. radiata] Length = 534 Score = 87.8 bits (216), Expect = 1e-18 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 F Q+AK + L+ GDYVLLSNIYAEAERW EVERLRSEM+DLHV KQ G+SQIDM Sbjct: 474 FLQLAKLKSLSDGDYVLLSNIYAEAERWDEVERLRSEMIDLHVSKQVGHSQIDM 527 >XP_017426186.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Vigna angularis] KOM44809.1 hypothetical protein LR48_Vigan06g011500 [Vigna angularis] Length = 534 Score = 87.8 bits (216), Expect = 1e-18 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 F Q+AK + L+ GDYVLLSNIYAEAERW EVERLRSEM+DLHV KQ G+SQIDM Sbjct: 474 FLQLAKLKSLSDGDYVLLSNIYAEAERWDEVERLRSEMIDLHVSKQVGHSQIDM 527 >XP_007157299.1 hypothetical protein PHAVU_002G058400g [Phaseolus vulgaris] ESW29293.1 hypothetical protein PHAVU_002G058400g [Phaseolus vulgaris] Length = 536 Score = 87.8 bits (216), Expect = 1e-18 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDM 73 FQQ+ K + LT GDYVLLSNIYAEAERW EVER+RSEM+DLHV K+ G+SQIDM Sbjct: 475 FQQLVKLKSLTDGDYVLLSNIYAEAERWDEVERVRSEMIDLHVSKKVGHSQIDM 528 >XP_003607207.1 PPR containing plant-like protein [Medicago truncatula] AES89404.1 PPR containing plant-like protein [Medicago truncatula] Length = 542 Score = 85.5 bits (210), Expect = 1e-17 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 F+Q+AK + L GDYVLLSNIYAEA RW EVERLRSEM LHVP+QAGYSQI+MK Sbjct: 482 FKQLAKLKQLIDGDYVLLSNIYAEAGRWDEVERLRSEMDYLHVPRQAGYSQINMK 536 >XP_003609024.1 PPR containing plant-like protein [Medicago truncatula] AES91221.1 PPR containing plant-like protein [Medicago truncatula] Length = 544 Score = 85.5 bits (210), Expect = 1e-17 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 F+Q+AK + L GDYVLLSNIYAEA RW EVERLRSEM LHVP+QAGYSQI+MK Sbjct: 484 FKQLAKLKQLIDGDYVLLSNIYAEAGRWDEVERLRSEMDYLHVPRQAGYSQINMK 538 >ONI03928.1 hypothetical protein PRUPE_6G292100 [Prunus persica] Length = 514 Score = 77.8 bits (190), Expect = 5e-15 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQQ+AK E L DYVLLSNIYAEAERW +VERLR+EM+ VPK G+S +DMK Sbjct: 460 FQQLAKLEPLRDADYVLLSNIYAEAERWDDVERLRNEMICKEVPKTLGFSHVDMK 514 >XP_008245013.1 PREDICTED: pentatricopeptide repeat-containing protein At4g18840-like [Prunus mume] Length = 578 Score = 76.3 bits (186), Expect = 2e-14 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQQ+AK E L DYVLLSNIYAEAERW +VERLR+EM+ VPK G+S ++MK Sbjct: 524 FQQLAKLEPLRDADYVLLSNIYAEAERWDDVERLRNEMIFKEVPKTLGFSHVEMK 578 >GAU36942.1 hypothetical protein TSUD_62110 [Trifolium subterraneum] Length = 338 Score = 73.6 bits (179), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQ 82 FQQ+AK + LT GDY+LLSNIYAEA RW EV+RLRSEM LHV KQAGYS+ Sbjct: 287 FQQLAKGQ-LTDGDYMLLSNIYAEAGRWDEVQRLRSEMAYLHVSKQAGYSK 336 >XP_018828577.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Juglans regia] Length = 531 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQ++AK E LT GDYVLLSNIYAE+ERW VERLR+EM+ + V K+ G S I+M+ Sbjct: 477 FQELAKLEALTDGDYVLLSNIYAESERWDNVERLRNEMIGVGVLKKLGSSNIEMR 531 >GAV77181.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 532 Score = 72.0 bits (175), Expect = 5e-13 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQQ+AK + L GDYVLLSNIYAEAERW VE++R++M+ VPK+ G S I+MK Sbjct: 478 FQQLAKLDALRDGDYVLLSNIYAEAERWDNVEQVRNQMIGNKVPKKLGSSHIEMK 532 >XP_004305084.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Fragaria vesca subsp. vesca] Length = 537 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 F+Q+AK E L DYVLLSNIYAEA++W V+RLR+EMV VPK G+S ++MK Sbjct: 483 FEQLAKLEPLKDADYVLLSNIYAEAKKWDGVQRLRNEMVCKGVPKSLGFSHVEMK 537 >XP_015897390.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like, partial [Ziziphus jujuba] Length = 467 Score = 68.9 bits (167), Expect = 7e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQQ+AK E L DYVLLSNIYAEA RW VERLR+EM+++ V K G S I+MK Sbjct: 409 FQQLAKLEPLKDADYVLLSNIYAEAGRWDNVERLRNEMINMGVLKILGSSHIEMK 463 >KCW53921.1 hypothetical protein EUGRSUZ_J03132 [Eucalyptus grandis] Length = 486 Score = 68.2 bits (165), Expect = 1e-11 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQ++ E GDYVLLSNIY+EA RWG+VE LR EM+D V K+ G S I+MK Sbjct: 432 FQELTDLEPTQDGDYVLLSNIYSEARRWGDVELLRGEMIDFSVTKRPGSSNIEMK 486 >XP_010034051.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15300 isoform X2 [Eucalyptus grandis] Length = 493 Score = 68.2 bits (165), Expect = 1e-11 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = -2 Query: 234 FQQVAKFEHLTHGDYVLLSNIYAEAERWGEVERLRSEMVDLHVPKQAGYSQIDMK 70 FQ++ E GDYVLLSNIY+EA RWG+VE LR EM+D V K+ G S I+MK Sbjct: 439 FQELTDLEPTQDGDYVLLSNIYSEARRWGDVELLRGEMIDFSVTKRPGSSNIEMK 493