BLASTX nr result
ID: Glycyrrhiza30_contig00031048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00031048 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAC32125.1 actin, partial [Picea mariana] 89 3e-21 WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OI... 89 5e-21 JAU90273.1 Actin, partial [Noccaea caerulescens] 89 6e-21 JAU26149.1 Actin, partial [Noccaea caerulescens] 89 8e-21 JAU98109.1 Actin [Noccaea caerulescens] 89 9e-21 BAB60900.1 actin, partial [Ipomoea nil] 89 1e-20 CAA10126.1 actin, partial [Cicer arietinum] 89 1e-20 AFK39692.1 unknown [Medicago truncatula] 89 1e-20 JAU24264.1 Actin-3, partial [Noccaea caerulescens] 89 2e-20 AAC60565.1 actin, partial [Striga asiatica] 89 2e-20 AHA91825.1 actin-1, partial [Rosa hybrid cultivar] 88 2e-20 AEG78680.1 actin, partial [Erythroxylum coca] 86 3e-20 AML60265.1 actin 4, partial [Morus alba] 86 3e-20 KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] 86 4e-20 XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphal... 88 4e-20 AAT37544.1 actin 1.6, partial [Hydra vulgaris] AAT37545.1 actin ... 86 4e-20 AAX92681.1 actin, partial [Picea abies] 89 5e-20 AAW83504.1 actin, partial [Ipomoea batatas] 87 5e-20 KHN84516.1 Actin-1 [Toxocara canis] KIH65223.1 hypothetical prot... 86 5e-20 CAB61444.1 unnamed protein product, partial [Drosophila melanoga... 86 5e-20 >AAC32125.1 actin, partial [Picea mariana] Length = 53 Score = 89.0 bits (219), Expect = 3e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 13 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 53 >WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OIC63224.1 hypothetical protein A7L55_18690 [Acinetobacter baumannii] Length = 71 Score = 89.0 bits (219), Expect = 5e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 31 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 71 >JAU90273.1 Actin, partial [Noccaea caerulescens] Length = 79 Score = 89.0 bits (219), Expect = 6e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 39 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 79 >JAU26149.1 Actin, partial [Noccaea caerulescens] Length = 90 Score = 89.0 bits (219), Expect = 8e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 50 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 90 >JAU98109.1 Actin [Noccaea caerulescens] Length = 93 Score = 89.0 bits (219), Expect = 9e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 53 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 93 >BAB60900.1 actin, partial [Ipomoea nil] Length = 100 Score = 89.0 bits (219), Expect = 1e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 60 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 100 >CAA10126.1 actin, partial [Cicer arietinum] Length = 103 Score = 89.0 bits (219), Expect = 1e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 63 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 103 >AFK39692.1 unknown [Medicago truncatula] Length = 110 Score = 89.0 bits (219), Expect = 1e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 70 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 110 >JAU24264.1 Actin-3, partial [Noccaea caerulescens] Length = 113 Score = 89.0 bits (219), Expect = 2e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 73 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 113 >AAC60565.1 actin, partial [Striga asiatica] Length = 114 Score = 89.0 bits (219), Expect = 2e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 74 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 114 >AHA91825.1 actin-1, partial [Rosa hybrid cultivar] Length = 84 Score = 87.8 bits (216), Expect = 2e-20 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKCF Sbjct: 44 RKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 84 >AEG78680.1 actin, partial [Erythroxylum coca] Length = 45 Score = 86.3 bits (212), Expect = 3e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 5 RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 45 >AML60265.1 actin 4, partial [Morus alba] Length = 47 Score = 86.3 bits (212), Expect = 3e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 7 RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 47 >KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] Length = 51 Score = 86.3 bits (212), Expect = 4e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 11 RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 51 >XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphalaria glabrata] Length = 107 Score = 87.8 bits (216), Expect = 4e-20 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKCF Sbjct: 67 RKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 107 >AAT37544.1 actin 1.6, partial [Hydra vulgaris] AAT37545.1 actin 1.7, partial [Hydra vulgaris] Length = 45 Score = 85.9 bits (211), Expect = 4e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 5 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 45 >AAX92681.1 actin, partial [Picea abies] Length = 155 Score = 89.0 bits (219), Expect = 5e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 115 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 155 >AAW83504.1 actin, partial [Ipomoea batatas] Length = 77 Score = 86.7 bits (213), Expect = 5e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLST QQMWIAKAEYDESGPSIVHRKCF Sbjct: 37 RKYSVWIGGSILASLSTLQQMWIAKAEYDESGPSIVHRKCF 77 >KHN84516.1 Actin-1 [Toxocara canis] KIH65223.1 hypothetical protein ANCDUO_04453 [Ancylostoma duodenale] Length = 51 Score = 85.9 bits (211), Expect = 5e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 11 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 51 >CAB61444.1 unnamed protein product, partial [Drosophila melanogaster] Length = 53 Score = 85.9 bits (211), Expect = 5e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 372 RKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 250 RKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 13 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 53