BLASTX nr result
ID: Glycyrrhiza30_contig00030550
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00030550 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013462724.1 DVL family protein [Medicago truncatula] KEH36759... 67 2e-11 KZM85432.1 hypothetical protein DCAR_027146 [Daucus carota subsp... 62 4e-08 XP_011091052.1 PREDICTED: uncharacterized protein LOC105171589 [... 55 1e-07 XP_019224928.1 PREDICTED: uncharacterized protein LOC109206553 [... 52 3e-06 >XP_013462724.1 DVL family protein [Medicago truncatula] KEH36759.1 DVL family protein [Medicago truncatula] Length = 104 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +2 Query: 134 LMGNTGRRFSKWRRFVRQQKGKLYIMRMCISMLLNWHK 247 +MG +RF+KWRR VRQQ+GK+YIMR+CI+MLLNWHK Sbjct: 1 MMGCMSKRFAKWRRMVRQQQGKIYIMRICITMLLNWHK 38 >KZM85432.1 hypothetical protein DCAR_027146 [Daucus carota subsp. sativus] Length = 321 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 137 MGNTGRRFSKWRRFVRQQKGKLYIMRMCISMLLNWHKYS 253 MG RRF+K +RFVRQQ+GKLYIMR CISMLL W KYS Sbjct: 278 MGRLVRRFAKLKRFVRQQRGKLYIMRECISMLLCWDKYS 316 >XP_011091052.1 PREDICTED: uncharacterized protein LOC105171589 [Sesamum indicum] Length = 37 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +2 Query: 149 GRRFSKWRRFVRQQKGKLYIMRMCISMLLNW-HKYS 253 G+RF KWRR V+Q +GKLYIMR+CI+MLL W KYS Sbjct: 2 GKRFGKWRRMVKQLRGKLYIMRVCITMLLCWDDKYS 37 >XP_019224928.1 PREDICTED: uncharacterized protein LOC109206553 [Nicotiana attenuata] Length = 55 Score = 52.0 bits (123), Expect = 3e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +2 Query: 155 RFSKWRRFVRQQKGKLYIMRMCISMLLNWHKYS 253 RF K +R V+QQKGKLYIMR+CI+MLL W YS Sbjct: 23 RFEKVKRMVKQQKGKLYIMRICITMLLCWDNYS 55