BLASTX nr result
ID: Glycyrrhiza30_contig00029846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029846 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008778590.1 PREDICTED: uncharacterized protein LOC103698369 [... 87 3e-19 OMO80899.1 reverse transcriptase [Corchorus capsularis] 89 1e-18 OMO58913.1 reverse transcriptase [Corchorus capsularis] 87 1e-17 XP_017696450.1 PREDICTED: uncharacterized protein LOC108510821, ... 83 1e-17 OMO55593.1 reverse transcriptase [Corchorus capsularis] 86 1e-17 XP_008780072.1 PREDICTED: uncharacterized protein LOC103699849, ... 82 2e-17 KZV26699.1 hypothetical protein F511_25442 [Dorcoceras hygrometr... 81 4e-17 GAV85487.1 Chromo domain-containing protein [Cephalotus follicul... 79 1e-16 GAV59055.1 Chromo domain-containing protein [Cephalotus follicul... 79 1e-16 XP_008780602.1 PREDICTED: uncharacterized protein LOC103700436, ... 77 3e-16 XP_017698858.1 PREDICTED: uncharacterized protein LOC108511389, ... 82 4e-16 XP_017700366.1 PREDICTED: uncharacterized protein LOC108511597 [... 82 6e-16 GAV80957.1 Chromo domain-containing protein [Cephalotus follicul... 77 7e-16 OMO91869.1 reverse transcriptase [Corchorus capsularis] 81 1e-15 XP_010910566.1 PREDICTED: uncharacterized protein LOC105036500, ... 76 1e-15 GAV63589.1 Chromo domain-containing protein [Cephalotus follicul... 76 1e-15 GAV77202.1 Chromo domain-containing protein [Cephalotus follicul... 76 1e-15 GAV82008.1 Chromo domain-containing protein [Cephalotus follicul... 75 3e-15 GAV75849.1 Chromo domain-containing protein [Cephalotus follicul... 75 4e-15 GAV88052.1 Chromo domain-containing protein [Cephalotus follicul... 75 4e-15 >XP_008778590.1 PREDICTED: uncharacterized protein LOC103698369 [Phoenix dactylifera] Length = 186 Score = 86.7 bits (213), Expect = 3e-19 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P +IVDRKDQVLR RTIPYVKVQW NHSEREATWELEE+MRE+ P LF Sbjct: 137 PIRIVDRKDQVLRRRTIPYVKVQWNNHSEREATWELEEEMREKFPTLF 184 >OMO80899.1 reverse transcriptase [Corchorus capsularis] Length = 1087 Score = 89.4 bits (220), Expect = 1e-18 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDTPG 150 P KIVDRK+QVLR RTIPYVKVQW NHSEREATWELE K++E++P LF+T G Sbjct: 1035 PIKIVDRKEQVLRRRTIPYVKVQWHNHSEREATWELESKIKEKYPELFETNG 1086 >OMO58913.1 reverse transcriptase [Corchorus capsularis] Length = 1477 Score = 86.7 bits (213), Expect = 1e-17 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDTPG 150 P KIVDRK+QVLR RTIPYVK+QW NHSEREATWELE +++E++P LF+T G Sbjct: 1425 PIKIVDRKEQVLRRRTIPYVKMQWHNHSEREATWELESEIKEKYPELFETNG 1476 >XP_017696450.1 PREDICTED: uncharacterized protein LOC108510821, partial [Phoenix dactylifera] Length = 208 Score = 83.2 bits (204), Expect = 1e-17 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 P +IVDRKDQVLR R IPYVKVQW +HSEREATWELE++M++++P LF+T Sbjct: 158 PVQIVDRKDQVLRHRVIPYVKVQWSHHSEREATWELEDEMKQKYPQLFET 207 >OMO55593.1 reverse transcriptase [Corchorus capsularis] Length = 1385 Score = 86.3 bits (212), Expect = 1e-17 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 P KIVDRK+QVLR RTIPYVKVQW NHSEREATWELE +++E++P LF+T Sbjct: 1333 PIKIVDRKEQVLRRRTIPYVKVQWHNHSEREATWELESEIKEKYPELFET 1382 >XP_008780072.1 PREDICTED: uncharacterized protein LOC103699849, partial [Phoenix dactylifera] Length = 200 Score = 82.4 bits (202), Expect = 2e-17 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 P +I+DRK+Q+LR RTIPYVKVQW NH+EREATWELEE+MR+ +P LF+ Sbjct: 150 PLRIIDRKEQILRRRTIPYVKVQWTNHTEREATWELEEEMRQCYPQLFE 198 >KZV26699.1 hypothetical protein F511_25442 [Dorcoceras hygrometricum] Length = 181 Score = 81.3 bits (199), Expect = 4e-17 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 P +IVD KDQVLR R IPYVKVQW NH EREATWELEEKM E +P+LF+ Sbjct: 115 PIRIVDTKDQVLRRRIIPYVKVQWSNHIEREATWELEEKMPEHYPYLFE 163 >GAV85487.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 78.6 bits (192), Expect = 1e-16 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 P +I+D K+Q+LRT+TIP VKV WRNH EATWELEE +R+EHPHLF T Sbjct: 76 PVEILDYKEQILRTKTIPLVKVLWRNHGVEEATWELEETIRKEHPHLFKT 125 >GAV59055.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 130 Score = 78.6 bits (192), Expect = 1e-16 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDTPGKSF 141 P +I+D K+QVLR++TIP VKV WRNH +EATWELEE MR+E+PHLF T F Sbjct: 76 PVEILDYKEQVLRSKTIPLVKVLWRNHKVKEATWELEEMMRQEYPHLFKTTCNKF 130 >XP_008780602.1 PREDICTED: uncharacterized protein LOC103700436, partial [Phoenix dactylifera] Length = 126 Score = 77.4 bits (189), Expect = 3e-16 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 +I+DRK+QVLR TIPYVKVQW NHSEREATW+LE+ MR HP LF Sbjct: 78 RIIDRKEQVLRWCTIPYVKVQWSNHSEREATWKLEDDMRARHPQLF 123 >XP_017698858.1 PREDICTED: uncharacterized protein LOC108511389, partial [Phoenix dactylifera] Length = 1231 Score = 82.0 bits (201), Expect = 4e-16 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 P +I+DRK+QVLR RTIPYVKVQW NHSEREATWELE++M HP F+ Sbjct: 1181 PLRIIDRKEQVLRRRTIPYVKVQWSNHSEREATWELEDEMHARHPQFFE 1229 >XP_017700366.1 PREDICTED: uncharacterized protein LOC108511597 [Phoenix dactylifera] Length = 588 Score = 81.6 bits (200), Expect = 6e-16 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 P +IVD+K+Q+LR RTI YVK+QW NH+EREATWELEE+MR+ HP LF+ Sbjct: 539 PLRIVDKKEQILRRRTIHYVKIQWTNHTEREATWELEEEMRQSHPQLFE 587 >GAV80957.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 76.6 bits (187), Expect = 7e-16 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 P +I+D K+QVLRT+TIP VKV WRNH EATWELE+ MR+E+PHLF++ Sbjct: 76 PVEIMDYKEQVLRTKTIPLVKVLWRNHDMEEATWELEDTMRKEYPHLFES 125 >OMO91869.1 reverse transcriptase [Corchorus capsularis] Length = 1401 Score = 80.9 bits (198), Expect = 1e-15 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P +IVDRK+QVLR RTIP+VKVQW NH+ REATWE+EE MR+E+P+LF Sbjct: 1350 PIRIVDRKEQVLRRRTIPFVKVQWSNHTPREATWEMEEDMRKEYPYLF 1397 >XP_010910566.1 PREDICTED: uncharacterized protein LOC105036500, partial [Elaeis guineensis] Length = 126 Score = 75.9 bits (185), Expect = 1e-15 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P +IVD+KDQVLR R IPYVK+ W NHSEREATWELE +M+ ++P LF Sbjct: 76 PVRIVDKKDQVLRHRIIPYVKIHWSNHSEREATWELETEMKIKYPQLF 123 >GAV63589.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 75.9 bits (185), Expect = 1e-15 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P KI+D K+QVLRT+T+P VKV W+NH EATWELE+ MR+E+PHLF Sbjct: 76 PVKILDYKEQVLRTKTVPLVKVLWKNHEVEEATWELEDTMRQEYPHLF 123 >GAV77202.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 75.9 bits (185), Expect = 1e-15 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P KI+D K+QVLRT+T+P VKV W+NH EATWELE+ MR+E+PHLF Sbjct: 76 PVKILDYKEQVLRTKTVPLVKVLWKNHEVEEATWELEDAMRQEYPHLF 123 >GAV82008.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 75.1 bits (183), Expect = 3e-15 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 P KI+D K+Q+LRT+TIP VKV W+NH EATWELE+ MR+E+P+LF++ Sbjct: 76 PVKILDHKEQILRTKTIPLVKVLWKNHGVEEATWELEKTMRQEYPYLFES 125 >GAV75849.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 74.7 bits (182), Expect = 4e-15 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P +I+D K+QVLRT+TIP VKV W+NH EATWELE+ MR+E+PHLF Sbjct: 76 PVEILDYKEQVLRTKTIPLVKVLWKNHEVEEATWELEDTMRQEYPHLF 123 >GAV88052.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 74.7 bits (182), Expect = 4e-15 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 305 PEKIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 P +I+D K+Q+LRT+TIP VKV WRNH EATWELEE MR E+PH+F Sbjct: 76 PVEILDYKEQILRTKTIPLVKVLWRNHGVDEATWELEESMRHEYPHIF 123