BLASTX nr result
ID: Glycyrrhiza30_contig00029809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029809 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_050422445.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 65 2e-12 WP_024584457.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 64 5e-12 WP_050630365.1 hypothetical protein [Bradyrhizobium viridifuturi] 64 9e-12 WP_038387371.1 hypothetical protein [Bradyrhizobium elkanii] 63 1e-11 WP_016841379.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 63 1e-11 WP_057019038.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 62 5e-11 SDE23051.1 hypothetical protein SAMN05216337_102243 [Bradyrhizob... 61 7e-11 WP_076861547.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 61 7e-11 WP_050404376.1 hypothetical protein [Bradyrhizobium embrapense] 61 7e-11 WP_066509536.1 hypothetical protein [Bradyrhizobium sp. BR 10303... 61 1e-10 ERF79636.1 nitrite reductase (NAD(P)H) large subunit [Bradyrhizo... 59 4e-10 WP_029083487.1 hypothetical protein [Bradyrhizobium sp. th.b2] 57 2e-09 SED08899.1 hypothetical protein SAMN05444164_3652 [Bradyrhizobiu... 57 5e-09 WP_027536939.1 hypothetical protein [Bradyrhizobium sp. URHA0002] 53 1e-07 WP_063983688.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 52 3e-07 WP_074279048.1 hypothetical protein [Bradyrhizobium erythrophlei... 51 6e-07 WP_027535407.1 hypothetical protein [Bradyrhizobium sp. WSM3983] 51 6e-07 WP_027542977.1 hypothetical protein [Bradyrhizobium sp. WSM2254] 51 7e-07 WP_074823982.1 hypothetical protein [Bradyrhizobium lablabi] SDI... 51 9e-07 WP_038944466.1 hypothetical protein [Bradyrhizobium japonicum] 51 9e-07 >WP_050422445.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO71374.1 hypothetical protein AC628_28510 [Bradyrhizobium sp. NAS96.2] Length = 64 Score = 65.5 bits (158), Expect = 2e-12 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKT+TIQPVP+DNKSHKGPGSTPGVP Sbjct: 1 MMTKPKTKTIQPVPDDNKSHKGPGSTPGVP 30 >WP_024584457.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU52749.1 hypothetical protein QU41_02215 [Bradyrhizobium elkanii] OCX33014.1 hypothetical protein QU42_00945 [Bradyrhizobium sp. UASWS1016] Length = 64 Score = 64.3 bits (155), Expect = 5e-12 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKP+T+TIQPVP+DNKSHKGPGSTPGVP Sbjct: 1 MMTKPRTKTIQPVPDDNKSHKGPGSTPGVP 30 >WP_050630365.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 64 Score = 63.5 bits (153), Expect = 9e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKP+TRTIQPVP+DNKSHKGPGS PGVP Sbjct: 1 MMTKPRTRTIQPVPDDNKSHKGPGSAPGVP 30 >WP_038387371.1 hypothetical protein [Bradyrhizobium elkanii] Length = 64 Score = 63.2 bits (152), Expect = 1e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKT+TIQPVP+DNKSHKGPGSTP VP Sbjct: 1 MMTKPKTKTIQPVPDDNKSHKGPGSTPSVP 30 >WP_016841379.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] ODM82348.1 hypothetical protein A6X20_18185 [Bradyrhizobium elkanii] ODM85459.1 hypothetical protein A6452_12755 [Bradyrhizobium elkanii] OIM90584.1 hypothetical protein BLN97_32460 [Bradyrhizobium elkanii] Length = 64 Score = 63.2 bits (152), Expect = 1e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKT+TIQPVP+DNKSHKGPGSTP VP Sbjct: 1 MMTKPKTKTIQPVPDDNKSHKGPGSTPSVP 30 >WP_057019038.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KRP89814.1 hypothetical protein AOQ73_25960 [Bradyrhizobium pachyrhizi] OMI05855.1 hypothetical protein BSN85_23215 [Bradyrhizobium sp. UFLA 03-321] Length = 64 Score = 61.6 bits (148), Expect = 5e-11 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKT+TIQPVP+DNKSHKGPGS+P VP Sbjct: 1 MMTKPKTKTIQPVPDDNKSHKGPGSSPSVP 30 >SDE23051.1 hypothetical protein SAMN05216337_102243 [Bradyrhizobium sp. R5] Length = 63 Score = 61.2 bits (147), Expect = 7e-11 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKPKT+TIQPVP+DNKSHKGPGSTP VP Sbjct: 1 MTKPKTKTIQPVPDDNKSHKGPGSTPSVP 29 >WP_076861547.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 64 Score = 61.2 bits (147), Expect = 7e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKT+TIQPVP+DNKSHKGPGS P VP Sbjct: 1 MMTKPKTKTIQPVPDDNKSHKGPGSAPAVP 30 >WP_050404376.1 hypothetical protein [Bradyrhizobium embrapense] Length = 64 Score = 61.2 bits (147), Expect = 7e-11 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKP +TIQPVP DNKSHKGPGSTPGVP Sbjct: 1 MMTKPSNKTIQPVPEDNKSHKGPGSTPGVP 30 >WP_066509536.1 hypothetical protein [Bradyrhizobium sp. BR 10303] KWV52554.1 hypothetical protein AS156_10150 [Bradyrhizobium sp. BR 10303] Length = 64 Score = 60.8 bits (146), Expect = 1e-10 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKTR IQPVP DN+SHKGPGS PGVP Sbjct: 1 MMTKPKTRNIQPVPEDNQSHKGPGSAPGVP 30 >ERF79636.1 nitrite reductase (NAD(P)H) large subunit [Bradyrhizobium sp. DFCI-1] Length = 63 Score = 59.3 bits (142), Expect = 4e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKPKT+TIQPVP+DNKSHKGPGS P VP Sbjct: 1 MTKPKTKTIQPVPDDNKSHKGPGSAPSVP 29 >WP_029083487.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 64 Score = 57.4 bits (137), Expect = 2e-09 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKPKT IQPVP DN+SHKGPGS PGVP Sbjct: 1 MMTKPKTGNIQPVPADNQSHKGPGSAPGVP 30 >SED08899.1 hypothetical protein SAMN05444164_3652 [Bradyrhizobium erythrophlei] Length = 63 Score = 56.6 bits (135), Expect = 5e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKPKT IQPVP+DN+SHKGPGS PGVP Sbjct: 1 MTKPKTGNIQPVPDDNQSHKGPGSAPGVP 29 >WP_027536939.1 hypothetical protein [Bradyrhizobium sp. URHA0002] Length = 63 Score = 53.1 bits (126), Expect = 1e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKP T+TI PVP+DN+SHKGPGS P VP Sbjct: 1 MTKPTTKTITPVPDDNQSHKGPGSAPAVP 29 >WP_063983688.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] CUU19112.1 hypothetical protein CDS [Bradyrhizobium sp.] APG12513.1 hypothetical protein BKD09_RS29675 [Bradyrhizobium japonicum] Length = 63 Score = 52.0 bits (123), Expect = 3e-07 Identities = 20/29 (68%), Positives = 26/29 (89%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKP T+T++PVP +N+SHKGPGSTP +P Sbjct: 1 MTKPLTKTVKPVPAENQSHKGPGSTPSIP 29 >WP_074279048.1 hypothetical protein [Bradyrhizobium erythrophlei] SIO62206.1 hypothetical protein SAMN05443247_09160 [Bradyrhizobium erythrophlei] Length = 63 Score = 51.2 bits (121), Expect = 6e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKP T TI PVP+DN+SHKGPGS P VP Sbjct: 1 MTKPLTDTILPVPDDNRSHKGPGSAPAVP 29 >WP_027535407.1 hypothetical protein [Bradyrhizobium sp. WSM3983] Length = 63 Score = 51.2 bits (121), Expect = 6e-07 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKP T+T+QPVP++N+SHKG GSTP VP Sbjct: 1 MTKPLTKTVQPVPDENQSHKGAGSTPTVP 29 >WP_027542977.1 hypothetical protein [Bradyrhizobium sp. WSM2254] Length = 64 Score = 51.2 bits (121), Expect = 7e-07 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +1 Query: 151 MMTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MMTKP T+T+QPVP +N+SHKG GS P +P Sbjct: 1 MMTKPLTKTVQPVPEENQSHKGAGSAPSIP 30 >WP_074823982.1 hypothetical protein [Bradyrhizobium lablabi] SDI31869.1 hypothetical protein SAMN05444163_2483 [Bradyrhizobium ottawaense] SED64548.1 hypothetical protein SAMN05444171_4685 [Bradyrhizobium lablabi] SHL61009.1 hypothetical protein SAMN05444321_3501 [Bradyrhizobium lablabi] Length = 63 Score = 50.8 bits (120), Expect = 9e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKP T+ I PVP+DN+SHKGPGS P VP Sbjct: 1 MTKPLTKAITPVPDDNQSHKGPGSAPAVP 29 >WP_038944466.1 hypothetical protein [Bradyrhizobium japonicum] Length = 63 Score = 50.8 bits (120), Expect = 9e-07 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = +1 Query: 154 MTKPKTRTIQPVPNDNKSHKGPGSTPGVP 240 MTKP T+T++PVP +N+SHKGPGS P +P Sbjct: 1 MTKPLTKTVKPVPKENQSHKGPGSAPSIP 29