BLASTX nr result
ID: Glycyrrhiza30_contig00029718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029718 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV89210.1 hypothetical protein TanjilG_25022 [Lupinus angustifo... 64 2e-10 >OIV89210.1 hypothetical protein TanjilG_25022 [Lupinus angustifolius] Length = 234 Score = 63.5 bits (153), Expect = 2e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 36 SVRISDPYDMISGDPSQSSIKARASPLLDFTSN 134 S RISDPYDMISGDPSQ SIKARASPLLDFTSN Sbjct: 202 SFRISDPYDMISGDPSQYSIKARASPLLDFTSN 234