BLASTX nr result
ID: Glycyrrhiza30_contig00029458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029458 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019462812.1 PREDICTED: histidine-rich glycoprotein-like [Lupi... 52 2e-06 XP_013444096.1 hypothetical protein MTR_8g012580 [Medicago trunc... 51 3e-06 XP_014516105.1 PREDICTED: uncharacterized protein LOC106773861 [... 51 5e-06 XP_017441694.1 PREDICTED: uncharacterized histidine-rich protein... 51 5e-06 KYP35276.1 hypothetical protein KK1_043689 [Cajanus cajan] 50 7e-06 XP_004510247.1 PREDICTED: uncharacterized protein LOC101491406 [... 50 8e-06 >XP_019462812.1 PREDICTED: histidine-rich glycoprotein-like [Lupinus angustifolius] Length = 129 Score = 51.6 bits (122), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 260 IELXXXXXXXEPVFVLTDEWREFFAKSEARRKLE 159 IEL EPVFVLTDEWREFFAKSEA+RKLE Sbjct: 87 IELDDEELDDEPVFVLTDEWREFFAKSEAKRKLE 120 >XP_013444096.1 hypothetical protein MTR_8g012580 [Medicago truncatula] KEH18123.1 hypothetical protein MTR_8g012580 [Medicago truncatula] Length = 124 Score = 51.2 bits (121), Expect = 3e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 260 IELXXXXXXXEPVFVLTDEWREFFAKSEARRKLE 159 IEL EP+FVLTDEWREFFAKSEA+RKLE Sbjct: 82 IELDGDEEDDEPIFVLTDEWREFFAKSEAKRKLE 115 >XP_014516105.1 PREDICTED: uncharacterized protein LOC106773861 [Vigna radiata var. radiata] Length = 137 Score = 50.8 bits (120), Expect = 5e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 227 PVFVLTDEWREFFAKSEARRKLE 159 PVFVLTDEWREFFAKSEARRKLE Sbjct: 105 PVFVLTDEWREFFAKSEARRKLE 127 >XP_017441694.1 PREDICTED: uncharacterized histidine-rich protein DDB_G0274557-like isoform X1 [Vigna angularis] XP_017441695.1 PREDICTED: uncharacterized histidine-rich protein DDB_G0274557-like isoform X2 [Vigna angularis] KOM58346.1 hypothetical protein LR48_Vigan11g138000 [Vigna angularis] BAT97109.1 hypothetical protein VIGAN_09046600 [Vigna angularis var. angularis] Length = 137 Score = 50.8 bits (120), Expect = 5e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 227 PVFVLTDEWREFFAKSEARRKLE 159 PVFVLTDEWREFFAKSEARRKLE Sbjct: 105 PVFVLTDEWREFFAKSEARRKLE 127 >KYP35276.1 hypothetical protein KK1_043689 [Cajanus cajan] Length = 131 Score = 50.4 bits (119), Expect = 7e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 260 IELXXXXXXXEPVFVLTDEWREFFAKSEARRKLE 159 I+L EPVFVLTDEWREFFAKSEA+RKLE Sbjct: 89 IDLDGEEEDDEPVFVLTDEWREFFAKSEAKRKLE 122 >XP_004510247.1 PREDICTED: uncharacterized protein LOC101491406 [Cicer arietinum] Length = 105 Score = 49.7 bits (117), Expect = 8e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 227 PVFVLTDEWREFFAKSEARRKLE 159 PVFVLTDEWREFFAKSEA+RKLE Sbjct: 75 PVFVLTDEWREFFAKSEAKRKLE 97