BLASTX nr result
ID: Glycyrrhiza30_contig00029449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029449 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017424931.1 PREDICTED: putative pentatricopeptide repeat-cont... 82 2e-15 XP_007150840.1 hypothetical protein PHAVU_005G185300g [Phaseolus... 77 5e-14 XP_014501192.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 5e-14 OIW08337.1 hypothetical protein TanjilG_03013 [Lupinus angustifo... 75 2e-13 XP_019449048.1 PREDICTED: putative pentatricopeptide repeat-cont... 75 2e-13 KYP50404.1 Putative pentatricopeptide repeat-containing protein ... 74 1e-12 XP_014627345.1 PREDICTED: putative pentatricopeptide repeat-cont... 71 7e-12 KRG93487.1 hypothetical protein GLYMA_19G019400 [Glycine max] 71 7e-12 XP_014625221.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 1e-11 XP_014625206.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 2e-11 XP_009379228.1 PREDICTED: putative pentatricopeptide repeat-cont... 64 2e-09 XP_006465137.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 8e-09 XP_018677577.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 2e-08 KDO46846.1 hypothetical protein CISIN_1g006437mg [Citrus sinensis] 62 2e-08 OAY33293.1 hypothetical protein MANES_13G083600 [Manihot esculenta] 61 3e-08 XP_008380383.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 7e-08 XP_007217131.1 hypothetical protein PRUPE_ppa015612m2g, partial ... 59 1e-07 ONI15037.1 hypothetical protein PRUPE_3G022400 [Prunus persica] ... 59 2e-07 ONI15036.1 hypothetical protein PRUPE_3G022400 [Prunus persica] 59 2e-07 XP_008227981.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 3e-07 >XP_017424931.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna angularis] XP_017424932.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna angularis] Length = 656 Score = 81.6 bits (200), Expect = 2e-15 Identities = 47/99 (47%), Positives = 61/99 (61%) Frame = -3 Query: 297 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 118 MIWSW+ K T + + S+ K++ + + S+S++ T+S C Sbjct: 1 MIWSWMWRRKG-----TGLGWRLRLMQCHSSSAWCCGQRQKQKEKQRVNSQSLKLTVSRC 55 Query: 117 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHRY 1 PSDLIALSFFLW+AQ RRRHD VALDH+V VL RLTHRY Sbjct: 56 PSDLIALSFFLWTAQ-RRRHDLVALDHIVTVLRRLTHRY 93 >XP_007150840.1 hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] ESW22834.1 hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] Length = 653 Score = 77.4 bits (189), Expect = 5e-14 Identities = 47/99 (47%), Positives = 59/99 (59%) Frame = -3 Query: 297 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 118 MIWSWL K + R + SS +R+ + V S+S++ T+S C Sbjct: 1 MIWSWLWRRKGIIGWRLR--------PMQCHSSSSASWCGQRQKQKV-NSQSLKRTVSRC 51 Query: 117 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHRY 1 PSDLIALSFFLW+AQRRR H + LDH+V VL RLTHRY Sbjct: 52 PSDLIALSFFLWTAQRRRHH-LLPLDHIVTVLRRLTHRY 89 >XP_014501192.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna radiata var. radiata] Length = 656 Score = 77.4 bits (189), Expect = 5e-14 Identities = 44/99 (44%), Positives = 59/99 (59%) Frame = -3 Query: 297 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 118 MIWSW+ K T + + S+ K++ + + S+S++ T+S C Sbjct: 1 MIWSWMCRRKG-----TGIGWRLRLMQCHSSSAWCCGQKQKQKEKQRVNSQSLKLTVSRC 55 Query: 117 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHRY 1 PSDLIALS FLW+AQ RRRHD A+DH+V VL RLTHRY Sbjct: 56 PSDLIALSLFLWTAQ-RRRHDMAAIDHIVTVLRRLTHRY 93 >OIW08337.1 hypothetical protein TanjilG_03013 [Lupinus angustifolius] Length = 652 Score = 75.5 bits (184), Expect = 2e-13 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = -3 Query: 207 FSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMV 31 F S FP K ++ V+L ++V TLS CPSDLIALSFFLWSAQR HDS+ALD MV Sbjct: 37 FPSPFP---HKTKTNVLLNRDNVHSTLSKCPSDLIALSFFLWSAQRHGCSHDSLALDRMV 93 Query: 30 AVLARLTHRY 1 VL LT+RY Sbjct: 94 TVLQSLTNRY 103 >XP_019449048.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] XP_019449049.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] XP_019449050.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] Length = 697 Score = 75.5 bits (184), Expect = 2e-13 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = -3 Query: 207 FSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMV 31 F S FP K ++ V+L ++V TLS CPSDLIALSFFLWSAQR HDS+ALD MV Sbjct: 82 FPSPFP---HKTKTNVLLNRDNVHSTLSKCPSDLIALSFFLWSAQRHGCSHDSLALDRMV 138 Query: 30 AVLARLTHRY 1 VL LT+RY Sbjct: 139 TVLQSLTNRY 148 >KYP50404.1 Putative pentatricopeptide repeat-containing protein At1g16830 family [Cajanus cajan] Length = 647 Score = 73.6 bits (179), Expect = 1e-12 Identities = 44/99 (44%), Positives = 56/99 (56%) Frame = -3 Query: 297 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 118 MIWSWL +S ++ + T + Q S K++ +V +WTLS Sbjct: 1 MIWSWLWASTGIRIGLRLKRTQRVGGCVVCLCHQCDYSSQKQKGKV-------KWTLSRS 53 Query: 117 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHRY 1 PSDL+ALS FLWSAQ RR D+VALD MV VL RL+ RY Sbjct: 54 PSDLVALSLFLWSAQ-RRHPDTVALDDMVTVLRRLSERY 91 >XP_014627345.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627346.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627347.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627348.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627349.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627350.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627351.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] Length = 599 Score = 71.2 bits (173), Expect = 7e-12 Identities = 41/61 (67%), Positives = 43/61 (70%) Frame = -3 Query: 183 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHR 4 SSK R + SES LS CPSDLIALS FLWSAQ RRRHDS A D +V VL RLTHR Sbjct: 24 SSKWRRRNTVNSES----LSRCPSDLIALSLFLWSAQ-RRRHDSFAFDRIVTVLLRLTHR 78 Query: 3 Y 1 Y Sbjct: 79 Y 79 >KRG93487.1 hypothetical protein GLYMA_19G019400 [Glycine max] Length = 603 Score = 71.2 bits (173), Expect = 7e-12 Identities = 41/61 (67%), Positives = 43/61 (70%) Frame = -3 Query: 183 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHR 4 SSK R + SES LS CPSDLIALS FLWSAQ RRRHDS A D +V VL RLTHR Sbjct: 24 SSKWRRRNTVNSES----LSRCPSDLIALSLFLWSAQ-RRRHDSFAFDRIVTVLLRLTHR 78 Query: 3 Y 1 Y Sbjct: 79 Y 79 >XP_014625221.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X2 [Glycine max] Length = 338 Score = 70.1 bits (170), Expect = 1e-11 Identities = 40/61 (65%), Positives = 42/61 (68%) Frame = -3 Query: 183 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHR 4 SSK R + SE TLS CPSDLIA S FLWSAQ RRRHDS A D +V VL RLTHR Sbjct: 24 SSKWRRRNTVNSE----TLSRCPSDLIAFSLFLWSAQ-RRRHDSFAFDRIVTVLRRLTHR 78 Query: 3 Y 1 Y Sbjct: 79 Y 79 >XP_014625206.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625207.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625208.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625209.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625210.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625211.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625212.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625213.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625214.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625215.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625216.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625217.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625218.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625219.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625220.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] KRH05318.1 hypothetical protein GLYMA_17G219900 [Glycine max] Length = 643 Score = 70.1 bits (170), Expect = 2e-11 Identities = 40/61 (65%), Positives = 42/61 (68%) Frame = -3 Query: 183 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVLARLTHR 4 SSK R + SE TLS CPSDLIA S FLWSAQ RRRHDS A D +V VL RLTHR Sbjct: 24 SSKWRRRNTVNSE----TLSRCPSDLIAFSLFLWSAQ-RRRHDSFAFDRIVTVLRRLTHR 78 Query: 3 Y 1 Y Sbjct: 79 Y 79 >XP_009379228.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379232.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379233.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379236.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379237.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379238.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379239.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_018507949.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] Length = 663 Score = 63.9 bits (154), Expect = 2e-09 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -3 Query: 195 FPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVLA 19 FP + + RSE++L + V TL C SDLIAL FFLW A QR H+ + +DHMV V+ Sbjct: 46 FPKIFDRERSELILNHQVVHSTLLKCSSDLIALRFFLWCAGQRNYFHNKIVIDHMVGVIK 105 Query: 18 RLTHRY 1 R+ +Y Sbjct: 106 RMMEQY 111 >XP_006465137.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_006465138.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_006465139.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384676.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384678.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384682.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384686.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384687.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384692.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] Length = 645 Score = 62.4 bits (150), Expect = 8e-09 Identities = 39/93 (41%), Positives = 52/93 (55%), Gaps = 4/93 (4%) Frame = -3 Query: 267 QMKKTITRFTTHTQ---PQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIAL 97 Q+ KTI F + Q P+ A FP ++L + V TL +CPSDLIAL Sbjct: 17 QILKTIISFKSIHQISSPKVCATTHQDFP---------IILAPQIVHSTLLNCPSDLIAL 67 Query: 96 SFFLWSA-QRRRRHDSVALDHMVAVLARLTHRY 1 SFF+W A QR HD + DHM++V+ RLT R+ Sbjct: 68 SFFIWCAKQRDYFHDVQSFDHMISVVTRLTGRF 100 >XP_018677577.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Musa acuminata subsp. malaccensis] Length = 641 Score = 61.6 bits (148), Expect = 2e-08 Identities = 39/85 (45%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSA- 76 + R T H ++ AFS Q P S + L E V T+SSCPSD IALSFFLW A Sbjct: 8 LCRLTPHRAFESPRAFSIQSP-----DSSRLQLCPEIVESTVSSCPSDTIALSFFLWCAR 62 Query: 75 QRRRRHDSVALDHMVAVLARLTHRY 1 Q HDS + D M+ V+ RLT R+ Sbjct: 63 QPNYFHDSCSFDRMIPVVLRLTDRF 87 >KDO46846.1 hypothetical protein CISIN_1g006437mg [Citrus sinensis] Length = 645 Score = 61.6 bits (148), Expect = 2e-08 Identities = 39/93 (41%), Positives = 51/93 (54%), Gaps = 4/93 (4%) Frame = -3 Query: 267 QMKKTITRFTTHTQ---PQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIAL 97 Q+ KTI F + Q P+ A FP ++L V TL +CPSDLIAL Sbjct: 17 QILKTIISFKSIHQISSPKVCATTHQDFP---------IILAPHIVHSTLLNCPSDLIAL 67 Query: 96 SFFLWSA-QRRRRHDSVALDHMVAVLARLTHRY 1 SFF+W A QR HD + DHM++V+ RLT R+ Sbjct: 68 SFFIWCAKQRDYFHDVQSFDHMISVVTRLTGRF 100 >OAY33293.1 hypothetical protein MANES_13G083600 [Manihot esculenta] Length = 658 Score = 60.8 bits (146), Expect = 3e-08 Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 7/106 (6%) Frame = -3 Query: 297 MIWSWLG----SSKQM--KKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVR 136 M+W + G S K++ K+ + + P + + + S+ +V L + V Sbjct: 1 MLWRYKGRVLPSLKKICILKSSSACNIFSSPMICLSMNDKTHQFFSRENLKVFLTPQIVH 60 Query: 135 WTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVLARLTHRY 1 TL +C SDLIALSFF+W A Q HD A D+MV+V+ARLT+RY Sbjct: 61 STLLNCRSDLIALSFFIWCAKQHNYFHDKQAFDYMVSVVARLTNRY 106 >XP_008380383.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380384.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380385.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380386.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380387.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380388.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380390.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380391.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_017189981.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] Length = 663 Score = 59.7 bits (143), Expect = 7e-08 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -3 Query: 195 FPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVLA 19 F + + +SE++L + V TL +C SDLIAL FFLW A QR H+ + +DHMV V+ Sbjct: 46 FQKIFDREKSELILNHQVVHSTLLNCSSDLIALRFFLWCAGQRNYFHNKIVIDHMVGVIK 105 Query: 18 RLTHRY 1 R+ +Y Sbjct: 106 RVMEQY 111 >XP_007217131.1 hypothetical protein PRUPE_ppa015612m2g, partial [Prunus persica] Length = 261 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 171 RSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVLARLTHRY 1 RS+ L ++V TL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ R+ RY Sbjct: 30 RSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVIKRMMERY 87 >ONI15037.1 hypothetical protein PRUPE_3G022400 [Prunus persica] ONI15038.1 hypothetical protein PRUPE_3G022400 [Prunus persica] Length = 663 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 171 RSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVLARLTHRY 1 RS+ L ++V TL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ R+ RY Sbjct: 54 RSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVIKRMMERY 111 >ONI15036.1 hypothetical protein PRUPE_3G022400 [Prunus persica] Length = 675 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 171 RSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVLARLTHRY 1 RS+ L ++V TL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ R+ RY Sbjct: 66 RSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVIKRMMERY 123 >XP_008227981.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Prunus mume] XP_016648837.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Prunus mume] Length = 663 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 171 RSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVLARLTHRY 1 RS+ L ++V TL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ R+ RY Sbjct: 54 RSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVIKRVMERY 111