BLASTX nr result
ID: Glycyrrhiza30_contig00029169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029169 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_029878978.1 MULTISPECIES: DUF805 domain-containing protein [B... 108 1e-28 >WP_029878978.1 MULTISPECIES: DUF805 domain-containing protein [Bradyrhizobium] KIU44976.1 hypothetical protein QU41_27600 [Bradyrhizobium elkanii] OCX26781.1 hypothetical protein QU42_34720 [Bradyrhizobium sp. UASWS1016] Length = 135 Score = 108 bits (271), Expect = 1e-28 Identities = 55/69 (79%), Positives = 59/69 (85%) Frame = -2 Query: 208 LYDLLFNFDGRISRAGYWRACIAWVIXXXXXLFVMIVLGSLMPYLAVAVMLIVWLLLLNS 29 ++DLLFNFDGRISRAGYWRACIAWVI LFVMIVLGSLMPYLAV V LI +L+ NS Sbjct: 1 MHDLLFNFDGRISRAGYWRACIAWVILLLLLLFVMIVLGSLMPYLAVCVALIAGVLMFNS 60 Query: 28 QIAVSKKRL 2 QIAVSKKRL Sbjct: 61 QIAVSKKRL 69