BLASTX nr result
ID: Glycyrrhiza30_contig00029158
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029158 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT94321.1 hypothetical protein VIGAN_08091300 [Vigna angularis ... 68 2e-13 >BAT94321.1 hypothetical protein VIGAN_08091300 [Vigna angularis var. angularis] Length = 74 Score = 67.8 bits (164), Expect = 2e-13 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = -3 Query: 144 GSKVALRVMIIPCIKMLLHSTLESLALFVLWICKVIDCCFCF 19 GSKVALRVMIIPCIKMLLHSTLE L LFV W K ID C CF Sbjct: 21 GSKVALRVMIIPCIKMLLHSTLEWLPLFVPWFKKPIDYCNCF 62