BLASTX nr result
ID: Glycyrrhiza30_contig00029080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029080 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP69882.1 RING-H2 finger protein ATL1E [Cajanus cajan] 115 8e-29 KHN23378.1 Putative RING-H2 finger protein ATL21A [Glycine soja] 115 1e-28 KRH53476.1 hypothetical protein GLYMA_06G127300 [Glycine max] 115 1e-28 XP_007136547.1 hypothetical protein PHAVU_009G054000g [Phaseolus... 114 2e-28 XP_014517969.1 PREDICTED: putative RING-H2 finger protein ATL21A... 112 9e-28 XP_017419758.1 PREDICTED: putative RING-H2 finger protein ATL21B... 112 9e-28 NP_001304375.1 RING-H2 finger protein ATL20 precursor [Glycine m... 112 1e-27 XP_016163352.1 PREDICTED: putative RING-H2 finger protein ATL21B... 104 1e-24 XP_015934387.1 PREDICTED: putative RING-H2 finger protein ATL21B... 104 2e-24 XP_003602221.1 RING-H2 finger ATL21B-like protein, putative [Med... 103 4e-24 XP_019435251.1 PREDICTED: putative RING-H2 finger protein ATL21A... 100 3e-23 XP_002513558.1 PREDICTED: putative RING-H2 finger protein ATL21B... 97 7e-22 XP_019260537.1 PREDICTED: putative RING-H2 finger protein ATL21A... 94 1e-20 OAY48443.1 hypothetical protein MANES_06G159100 [Manihot esculenta] 94 1e-20 XP_006422179.1 hypothetical protein CICLE_v10006544mg [Citrus cl... 94 2e-20 XP_009378776.1 PREDICTED: putative RING-H2 finger protein ATL21B... 92 5e-20 XP_008376731.1 PREDICTED: putative RING-H2 finger protein ATL21B... 92 5e-20 XP_010266503.1 PREDICTED: putative RING-H2 finger protein ATL21A... 92 5e-20 XP_010662987.1 PREDICTED: putative RING-H2 finger protein ATL21A... 92 7e-20 XP_010266502.1 PREDICTED: putative RING-H2 finger protein ATL21A... 92 7e-20 >KYP69882.1 RING-H2 finger protein ATL1E [Cajanus cajan] Length = 370 Score = 115 bits (288), Expect = 8e-29 Identities = 51/56 (91%), Positives = 51/56 (91%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*P 126 ICLSEY PKETVK IPECGHCFHAQCIDEWLPLNASCPICRTSP KLPQP ARS P Sbjct: 315 ICLSEYMPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTSPSKLPQPRARSSP 370 >KHN23378.1 Putative RING-H2 finger protein ATL21A [Glycine soja] Length = 385 Score = 115 bits (287), Expect = 1e-28 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*PR 123 ICLSEY PKETVK IPECGHCFHAQCIDEWLPLNASCPICRTSP KLPQP ARS P+ Sbjct: 329 ICLSEYIPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTSPRKLPQPRARSSPQ 385 >KRH53476.1 hypothetical protein GLYMA_06G127300 [Glycine max] Length = 385 Score = 115 bits (287), Expect = 1e-28 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*PR 123 ICLSEY PKETVK IPECGHCFHAQCIDEWLPLNASCPICRTSP KLPQP ARS P+ Sbjct: 329 ICLSEYIPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTSPRKLPQPRARSSPQ 385 >XP_007136547.1 hypothetical protein PHAVU_009G054000g [Phaseolus vulgaris] ESW08541.1 hypothetical protein PHAVU_009G054000g [Phaseolus vulgaris] Length = 380 Score = 114 bits (285), Expect = 2e-28 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*P 126 ICLSEY PKETVK+IPECGHCFHAQCIDEWLPLNASCPICRTSP K PQP ARS P Sbjct: 325 ICLSEYMPKETVKSIPECGHCFHAQCIDEWLPLNASCPICRTSPQKFPQPRARSSP 380 >XP_014517969.1 PREDICTED: putative RING-H2 finger protein ATL21A [Vigna radiata var. radiata] Length = 378 Score = 112 bits (281), Expect = 9e-28 Identities = 49/54 (90%), Positives = 50/54 (92%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS 132 ICLSEY PKETVK+IPECGHCFHAQCIDEWLPLNASCPICRTSP K PQP ARS Sbjct: 323 ICLSEYMPKETVKSIPECGHCFHAQCIDEWLPLNASCPICRTSPRKFPQPRARS 376 >XP_017419758.1 PREDICTED: putative RING-H2 finger protein ATL21B [Vigna angularis] KOM41401.1 hypothetical protein LR48_Vigan04g159900 [Vigna angularis] BAT78811.1 hypothetical protein VIGAN_02154600 [Vigna angularis var. angularis] Length = 379 Score = 112 bits (281), Expect = 9e-28 Identities = 49/54 (90%), Positives = 50/54 (92%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS 132 ICLSEY PKETVK+IPECGHCFHAQCIDEWLPLNASCPICRTSP K PQP ARS Sbjct: 324 ICLSEYMPKETVKSIPECGHCFHAQCIDEWLPLNASCPICRTSPRKFPQPRARS 377 >NP_001304375.1 RING-H2 finger protein ATL20 precursor [Glycine max] ACU24071.1 unknown [Glycine max] Length = 385 Score = 112 bits (281), Expect = 1e-27 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*PR 123 ICLSEY PKETVK IPECGHCFHAQCIDEWLPLNASCPICRT P KLPQP ARS P+ Sbjct: 329 ICLSEYIPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTFPRKLPQPRARSSPQ 385 >XP_016163352.1 PREDICTED: putative RING-H2 finger protein ATL21B [Arachis ipaensis] Length = 381 Score = 104 bits (260), Expect = 1e-24 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLP 150 PICLSEY+PKETVK IPEC HCFHAQCIDEWLPLNASCPICRTSP KLP Sbjct: 330 PICLSEYKPKETVKRIPECLHCFHAQCIDEWLPLNASCPICRTSPNKLP 378 >XP_015934387.1 PREDICTED: putative RING-H2 finger protein ATL21B [Arachis duranensis] Length = 431 Score = 104 bits (260), Expect = 2e-24 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLP 150 PICLSEY+PKETVK IPEC HCFHAQCIDEWLPLNASCPICRTSP KLP Sbjct: 380 PICLSEYKPKETVKRIPECLHCFHAQCIDEWLPLNASCPICRTSPNKLP 428 >XP_003602221.1 RING-H2 finger ATL21B-like protein, putative [Medicago truncatula] AES72472.1 RING-H2 finger ATL21B-like protein, putative [Medicago truncatula] Length = 388 Score = 103 bits (256), Expect = 4e-24 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKL 153 PICLSEY PKETVK +PEC HCFHAQCIDEWLPLNASCPICRTSPP+L Sbjct: 332 PICLSEYMPKETVKTMPECEHCFHAQCIDEWLPLNASCPICRTSPPRL 379 >XP_019435251.1 PREDICTED: putative RING-H2 finger protein ATL21A [Lupinus angustifolius] Length = 389 Score = 100 bits (250), Expect = 3e-23 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPL 141 PICLS+Y PKETVK IPEC H FHA+CIDEWLPLNASCPICRTSP LPQPL Sbjct: 335 PICLSKYRPKETVKHIPECRHGFHAKCIDEWLPLNASCPICRTSPHMLPQPL 386 >XP_002513558.1 PREDICTED: putative RING-H2 finger protein ATL21B [Ricinus communis] EEF48961.1 ring finger protein, putative [Ricinus communis] Length = 377 Score = 97.1 bits (240), Expect = 7e-22 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLAR 135 ICLSEY+PKET+K IPEC HCFHA CIDEWL LNASCPICR SP +LP P A+ Sbjct: 323 ICLSEYKPKETLKTIPECQHCFHADCIDEWLKLNASCPICRKSPDRLPPPPAQ 375 >XP_019260537.1 PREDICTED: putative RING-H2 finger protein ATL21A [Nicotiana attenuata] OIT39119.1 putative ring-h2 finger protein atl21a [Nicotiana attenuata] Length = 376 Score = 94.0 bits (232), Expect = 1e-20 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLA 138 PICL+EYEPKET++ IPEC HCFHA+CIDEWL LNASCP+CR SP P+PL+ Sbjct: 321 PICLAEYEPKETLRTIPECQHCFHAECIDEWLRLNASCPVCRNSPK--PKPLS 371 >OAY48443.1 hypothetical protein MANES_06G159100 [Manihot esculenta] Length = 371 Score = 93.6 bits (231), Expect = 1e-20 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQP 144 ICLSEY+PKET+K IPEC HCFH CIDEWL LNASCPICR SP +LP P Sbjct: 319 ICLSEYKPKETLKTIPECQHCFHVDCIDEWLRLNASCPICRNSPLQLPPP 368 >XP_006422179.1 hypothetical protein CICLE_v10006544mg [Citrus clementina] XP_015389535.1 PREDICTED: RING-H2 finger protein ATL20 [Citrus sinensis] ESR35419.1 hypothetical protein CICLE_v10006544mg [Citrus clementina] KDO46744.1 hypothetical protein CISIN_1g043654mg [Citrus sinensis] Length = 390 Score = 93.6 bits (231), Expect = 2e-20 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLP 150 PICL+EY+PKET+K IPEC HCFHA C+DEWL LNA+CP+CR SP +LP Sbjct: 325 PICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPARLP 373 >XP_009378776.1 PREDICTED: putative RING-H2 finger protein ATL21B [Pyrus x bretschneideri] Length = 366 Score = 92.0 bits (227), Expect = 5e-20 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPP 159 PICLSEY+PKET+K IP+C HCFHA CIDEWL +NA+CPICR SPP Sbjct: 321 PICLSEYQPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 366 >XP_008376731.1 PREDICTED: putative RING-H2 finger protein ATL21B [Malus domestica] Length = 366 Score = 92.0 bits (227), Expect = 5e-20 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPP 159 PICLSEY+PKET+K IP+C HCFHA CIDEWL +NA+CPICR SPP Sbjct: 321 PICLSEYQPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 366 >XP_010266503.1 PREDICTED: putative RING-H2 finger protein ATL21A isoform X2 [Nelumbo nucifera] Length = 378 Score = 92.0 bits (227), Expect = 5e-20 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQP 144 PICLSEY P ET+++IPEC HCFHA CIDEWL +NA+CP+CR SP LP P Sbjct: 322 PICLSEYRPNETLRSIPECKHCFHADCIDEWLKINATCPLCRNSPGPLPPP 372 >XP_010662987.1 PREDICTED: putative RING-H2 finger protein ATL21A [Vitis vinifera] Length = 367 Score = 91.7 bits (226), Expect = 7e-20 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -2 Query: 293 ICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLP 150 ICLSEY PKET+K IPEC HCFH++CIDEWL LNASCPICR SP K P Sbjct: 309 ICLSEYRPKETLKIIPECQHCFHSECIDEWLHLNASCPICRNSPAKSP 356 >XP_010266502.1 PREDICTED: putative RING-H2 finger protein ATL21A isoform X1 [Nelumbo nucifera] Length = 413 Score = 92.0 bits (227), Expect = 7e-20 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = -2 Query: 296 PICLSEYEPKETVKAIPECGHCFHAQCIDEWLPLNASCPICRTSPPKLPQP 144 PICLSEY P ET+++IPEC HCFHA CIDEWL +NA+CP+CR SP LP P Sbjct: 357 PICLSEYRPNETLRSIPECKHCFHADCIDEWLKINATCPLCRNSPGPLPPP 407