BLASTX nr result
ID: Glycyrrhiza30_contig00029057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029057 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACB83162.1 hypothetical protein Mpop_5066 [Methylobacterium popu... 65 1e-11 WP_056526508.1 hypothetical protein [Methylobacterium sp. Leaf36... 58 2e-09 WP_056409135.1 transposase [Methylobacterium sp. Leaf466] KQT787... 57 1e-08 WP_003604457.1 hypothetical protein [Methylobacterium extorquens... 60 1e-08 WP_056492507.1 transposase [Methylobacterium sp. Leaf111] KQP732... 60 2e-08 WP_053620554.1 transposase [Asanoa ferruginea] KOX61712.1 transp... 59 2e-08 SFU58864.1 hypothetical protein SAMN02799631_01307, partial [Met... 56 2e-08 SEP24478.1 Transposase InsO and inactivated derivatives [Rhodosp... 59 3e-08 SEF59395.1 Transposase InsO and inactivated derivatives [Methylo... 59 3e-08 WP_072928075.1 transposase, partial [Microcystis aeruginosa] 59 3e-08 WP_051439914.1 transposase [Methylobacterium sp. 10] 56 3e-08 WP_056304227.1 transposase [Methylobacterium sp. Leaf100] KQP326... 59 4e-08 WP_056271249.1 transposase [Methylobacterium sp. Leaf88] KQO7633... 59 4e-08 WP_063986951.1 transposase [Methylobacterium populi] OAH37852.1 ... 59 4e-08 WP_056480877.1 transposase [Methylobacterium sp. Leaf117] KQP953... 59 4e-08 WP_056187220.1 transposase [Methylobacterium sp. Leaf113] KQP803... 59 4e-08 WP_056357781.1 transposase [Methylobacterium sp. Leaf102] KQP346... 59 4e-08 WP_056355152.1 transposase [Methylobacterium sp. Leaf89] KQO6658... 59 4e-08 WP_018260937.1 transposase [Methylobacterium sp. WSM2598] 56 4e-08 WP_012340159.1 transposase [Methylobacterium radiotolerans] ACB2... 58 5e-08 >ACB83162.1 hypothetical protein Mpop_5066 [Methylobacterium populi BJ001] Length = 96 Score = 64.7 bits (156), Expect = 1e-11 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = +1 Query: 79 LLLGRSGAVAAVEIGSCPSMRWKFGVELERPSVRRPEVELL 201 L L S + EIGSCPSMRWKFGVELERPSVRRPEVELL Sbjct: 56 LELHASTGMTQQEIGSCPSMRWKFGVELERPSVRRPEVELL 96 >WP_056526508.1 hypothetical protein [Methylobacterium sp. Leaf361] KQS79999.1 hypothetical protein ASG32_24540 [Methylobacterium sp. Leaf361] Length = 76 Score = 58.2 bits (139), Expect = 2e-09 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARR 6 D R +YGVEPICRVLPIAPSTYHAHAARR Sbjct: 6 DDHREAYGVEPICRVLPIAPSTYHAHAARR 35 >WP_056409135.1 transposase [Methylobacterium sp. Leaf466] KQT78785.1 transposase [Methylobacterium sp. Leaf466] Length = 96 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARR 6 D R +YGVEPICRVLPIAPSTYHAHAARR Sbjct: 6 DDHRVAYGVEPICRVLPIAPSTYHAHAARR 35 >WP_003604457.1 hypothetical protein [Methylobacterium extorquens] EHP90138.1 hypothetical protein MetexDRAFT_4978 [Methylobacterium extorquens DSM 13060] Length = 262 Score = 59.7 bits (143), Expect = 1e-08 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -3 Query: 146 FHLIDGHDPISTAATAPDRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 F L P++ D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 97 FCLGGARPPVADMIAFIDDHRAAYGVEPICKVLPIAPSTYHAHAARRA 144 >WP_056492507.1 transposase [Methylobacterium sp. Leaf111] KQP73214.1 transposase [Methylobacterium sp. Leaf111] Length = 301 Score = 59.7 bits (143), Expect = 2e-08 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D RR YGVEPICRVLPIAPSTYHAH ARRA Sbjct: 6 DDHRRDYGVEPICRVLPIAPSTYHAHVARRA 36 >WP_053620554.1 transposase [Asanoa ferruginea] KOX61712.1 transposase [Asanoa ferruginea] Length = 301 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPICRVLPIAPSTYHAHAARRA Sbjct: 6 DDHRATYGVEPICRVLPIAPSTYHAHAARRA 36 >SFU58864.1 hypothetical protein SAMN02799631_01307, partial [Methylobacterium sp. 174MFSha1.1] Length = 84 Score = 55.8 bits (133), Expect = 2e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R YGVEPICRVLPIAPSTY+AHAARRA Sbjct: 6 DDHRAVYGVEPICRVLPIAPSTYYAHAARRA 36 >SEP24478.1 Transposase InsO and inactivated derivatives [Rhodospirillales bacterium URHD0017] Length = 301 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPICRVLPIAPSTYHAHAARRA Sbjct: 6 DDHRGAYGVEPICRVLPIAPSTYHAHAARRA 36 >SEF59395.1 Transposase InsO and inactivated derivatives [Methylobacterium sp. 190mf] Length = 301 Score = 58.9 bits (141), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DEHRATYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_072928075.1 transposase, partial [Microcystis aeruginosa] Length = 255 Score = 58.5 bits (140), Expect = 3e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R SYGVEPICRVLPIAPSTYHAHAA+RA Sbjct: 6 DDHRGSYGVEPICRVLPIAPSTYHAHAAQRA 36 >WP_051439914.1 transposase [Methylobacterium sp. 10] Length = 116 Score = 56.2 bits (134), Expect = 3e-08 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R YGVEPICRVLP APSTYHAHAARRA Sbjct: 6 DDHRAVYGVEPICRVLPTAPSTYHAHAARRA 36 >WP_056304227.1 transposase [Methylobacterium sp. Leaf100] KQP32665.1 transposase [Methylobacterium sp. Leaf100] Length = 286 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DEHRDAYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_056271249.1 transposase [Methylobacterium sp. Leaf88] KQO76333.1 transposase [Methylobacterium sp. Leaf88] Length = 299 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARR 6 D R +YGVEPICRVLPIAPSTYHAHAARR Sbjct: 4 DEHRATYGVEPICRVLPIAPSTYHAHAARR 33 >WP_063986951.1 transposase [Methylobacterium populi] OAH37852.1 transposase [Methylobacterium populi] Length = 301 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DDHREAYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_056480877.1 transposase [Methylobacterium sp. Leaf117] KQP95364.1 transposase [Methylobacterium sp. Leaf117] Length = 301 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DEHRDAYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_056187220.1 transposase [Methylobacterium sp. Leaf113] KQP80370.1 transposase [Methylobacterium sp. Leaf113] Length = 301 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DEHRDAYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_056357781.1 transposase [Methylobacterium sp. Leaf102] KQP34673.1 transposase [Methylobacterium sp. Leaf102] Length = 301 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DEHRDAYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_056355152.1 transposase [Methylobacterium sp. Leaf89] KQO66585.1 transposase [Methylobacterium sp. Leaf89] Length = 301 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPIC+VLPIAPSTYHAHAARRA Sbjct: 6 DEHRDAYGVEPICKVLPIAPSTYHAHAARRA 36 >WP_018260937.1 transposase [Methylobacterium sp. WSM2598] Length = 110 Score = 55.8 bits (133), Expect = 4e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARRA 3 D R +YGVEPICRVLPIAPSTYH H ARRA Sbjct: 6 DDHRDAYGVEPICRVLPIAPSTYHVHVARRA 36 >WP_012340159.1 transposase [Methylobacterium radiotolerans] ACB28346.1 Integrase catalytic region (plasmid) [Methylobacterium radiotolerans JCM 2831] ACB28377.1 Integrase catalytic region (plasmid) [Methylobacterium radiotolerans JCM 2831] Length = 301 Score = 58.2 bits (139), Expect = 5e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 95 DRPRRSYGVEPICRVLPIAPSTYHAHAARR 6 D R +YGVEPICRVLPIAPSTYHAHAARR Sbjct: 6 DDHREAYGVEPICRVLPIAPSTYHAHAARR 35