BLASTX nr result
ID: Glycyrrhiza30_contig00029007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00029007 (896 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM53246.1 hypothetical protein LR48_Vigan09g190500 [Vigna angul... 55 7e-06 >KOM53246.1 hypothetical protein LR48_Vigan09g190500 [Vigna angularis] KOM56662.1 hypothetical protein LR48_Vigan10g255400 [Vigna angularis] Length = 138 Score = 55.1 bits (131), Expect = 7e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -2 Query: 238 AQFLPHYLVLRSLSRLPVKSLVRNKCVSRRWDSLIFDKDFIKLHHDRA 95 A LP L+ LS LP KSL+R +CVS W+SLI + DF++LHH+R+ Sbjct: 8 ATILPDTLISEILSWLPAKSLMRFRCVSNTWNSLIINPDFLELHHERS 55