BLASTX nr result
ID: Glycyrrhiza30_contig00028641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00028641 (216 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572341.1 PREDICTED: uncharacterized protein LOC101503222 i... 53 3e-06 >XP_012572341.1 PREDICTED: uncharacterized protein LOC101503222 isoform X2 [Cicer arietinum] Length = 652 Score = 52.8 bits (125), Expect = 3e-06 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = +2 Query: 38 QKNVKASTDDKVVILDNPSNVFLEVDPGFIEEQETDAYMXXXXXXXXXXXSRAQNCQES 214 QK VK S + ++V+LDN SN L+VDPGF+EEQETD M SR QNCQ+S Sbjct: 16 QKKVKQSANVEMVVLDNLSNQ-LKVDPGFVEEQETD--MPKKRGRGRPKRSRDQNCQDS 71