BLASTX nr result
ID: Glycyrrhiza30_contig00028630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00028630 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019424586.1 PREDICTED: probable amino-acid acetyltransferase ... 53 8e-06 >XP_019424586.1 PREDICTED: probable amino-acid acetyltransferase NAGS1, chloroplastic isoform X2 [Lupinus angustifolius] OIV92840.1 hypothetical protein TanjilG_00974 [Lupinus angustifolius] Length = 612 Score = 52.8 bits (125), Expect = 8e-06 Identities = 29/57 (50%), Positives = 34/57 (59%) Frame = +2 Query: 128 MAACANSKPPMSLASQGETRLSSGPTCSYQFFNFGSRVRIERLSCCTVAAVRSERSK 298 MAA + KPPMSL SQGET LS TC QFF++G+RVR R C + R K Sbjct: 1 MAATSPIKPPMSLKSQGETWLSRATTCD-QFFSYGTRVRTRRFCSCGCVSRLQRRRK 56