BLASTX nr result
ID: Glycyrrhiza30_contig00028546
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00028546 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK36033.1 unknown [Medicago truncatula] 59 2e-07 XP_013449441.1 phenylalanyl-tRNA synthetase [Medicago truncatula... 59 3e-07 XP_017975681.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 59 4e-07 XP_003624422.2 phenylalanyl-tRNA synthetase [Medicago truncatula... 59 4e-07 XP_004491106.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 59 4e-07 XP_015881985.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 59 4e-07 EOY05185.1 Phenylalanyl-tRNA synthetase class IIc family protein... 59 4e-07 XP_006603042.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 6e-07 XP_016198928.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 6e-07 XP_015961599.1 PREDICTED: LOW QUALITY PROTEIN: phenylalanine--tR... 58 6e-07 XP_011003959.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 7e-07 XP_006376212.1 phenylalanyl-tRNA synthetase class IIc family pro... 58 7e-07 KYP64988.1 hypothetical protein KK1_019602 [Cajanus cajan] 58 7e-07 XP_010521580.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 7e-07 XP_010557471.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 7e-07 XP_014626360.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 7e-07 XP_002528951.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 7e-07 CAN62555.1 hypothetical protein VITISV_038609 [Vitis vinifera] 58 7e-07 XP_010557470.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 58 7e-07 XP_002270417.1 PREDICTED: phenylalanine--tRNA ligase, chloroplas... 57 9e-07 >AFK36033.1 unknown [Medicago truncatula] Length = 229 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CEVVRG+ Sbjct: 140 KYPPCYKDISFWINESFTENNLCEVVRGV 168 >XP_013449441.1 phenylalanyl-tRNA synthetase [Medicago truncatula] KEH23469.1 phenylalanyl-tRNA synthetase [Medicago truncatula] Length = 381 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CEVVRG+ Sbjct: 339 KYPPCYKDISFWINESFTENNLCEVVRGV 367 >XP_017975681.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Theobroma cacao] Length = 428 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CEV+RGI Sbjct: 339 KYPPCYKDISFWINESFTENNLCEVIRGI 367 >XP_003624422.2 phenylalanyl-tRNA synthetase [Medicago truncatula] AES80640.2 phenylalanyl-tRNA synthetase [Medicago truncatula] Length = 428 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CEVVRG+ Sbjct: 339 KYPPCYKDISFWINESFTENNLCEVVRGV 367 >XP_004491106.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Cicer arietinum] XP_004491107.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Cicer arietinum] XP_004491109.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Cicer arietinum] Length = 428 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CEVVRG+ Sbjct: 339 KYPPCYKDISFWINESFTENNLCEVVRGV 367 >XP_015881985.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Ziziphus jujuba] Length = 432 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 343 KYPPCYKDVSFWINESFTENNLCEVVRGI 371 >EOY05185.1 Phenylalanyl-tRNA synthetase class IIc family protein [Theobroma cacao] Length = 724 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CEV+RGI Sbjct: 635 KYPPCYKDISFWINESFTENNLCEVIRGI 663 >XP_006603042.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like isoform X2 [Glycine max] KRH01675.1 hypothetical protein GLYMA_18G291800 [Glycine max] Length = 373 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 284 KYPPCYKDMSFWINESFTENNLCEVVRGI 312 >XP_016198928.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Arachis ipaensis] Length = 398 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CE+VRGI Sbjct: 309 KYPPCYKDISFWINESFTENNLCELVRGI 337 >XP_015961599.1 PREDICTED: LOW QUALITY PROTEIN: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like [Arachis duranensis] Length = 423 Score = 57.8 bits (138), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKDISF INESFT+NN+CE+VRGI Sbjct: 334 KYPPCYKDISFWINESFTENNLCELVRGI 362 >XP_011003959.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Populus euphratica] Length = 426 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 337 KYPPCYKDMSFWINESFTENNLCEVVRGI 365 >XP_006376212.1 phenylalanyl-tRNA synthetase class IIc family protein [Populus trichocarpa] ERP54009.1 phenylalanyl-tRNA synthetase class IIc family protein [Populus trichocarpa] Length = 426 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 337 KYPPCYKDMSFWINESFTENNLCEVVRGI 365 >KYP64988.1 hypothetical protein KK1_019602 [Cajanus cajan] Length = 429 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 340 KYPPCYKDMSFWINESFTENNLCEVVRGI 368 >XP_010521580.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like [Tarenaya hassleriana] Length = 429 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 340 KYPPCYKDMSFWINESFTENNLCEVVRGI 368 >XP_010557471.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like isoform X2 [Tarenaya hassleriana] XP_010557472.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like isoform X2 [Tarenaya hassleriana] XP_010557473.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like isoform X2 [Tarenaya hassleriana] Length = 429 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 340 KYPPCYKDMSFWINESFTENNLCEVVRGI 368 >XP_014626360.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like isoform X1 [Glycine max] KRH01673.1 hypothetical protein GLYMA_18G291800 [Glycine max] KRH01674.1 hypothetical protein GLYMA_18G291800 [Glycine max] Length = 431 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 342 KYPPCYKDMSFWINESFTENNLCEVVRGI 370 >XP_002528951.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Ricinus communis] EEF33425.1 phenylalanyl-tRNA synthetase, putative [Ricinus communis] Length = 438 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 349 KYPPCYKDMSFWINESFTENNLCEVVRGI 377 >CAN62555.1 hypothetical protein VITISV_038609 [Vitis vinifera] Length = 452 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGIVECPIKIRQL 195 +YPPCYKD+SF INESFT+NN+CEVVRG+ ++ QL Sbjct: 348 KYPPCYKDMSFWINESFTENNLCEVVRGVAGDXVQEVQL 386 >XP_010557470.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like isoform X1 [Tarenaya hassleriana] Length = 489 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRGI Sbjct: 400 KYPPCYKDMSFWINESFTENNLCEVVRGI 428 >XP_002270417.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Vitis vinifera] XP_010656788.1 PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Vitis vinifera] CBI40135.3 unnamed protein product, partial [Vitis vinifera] Length = 427 Score = 57.4 bits (137), Expect = 9e-07 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 79 QYPPCYKDISF*INESFTKNNMCEVVRGI 165 +YPPCYKD+SF INESFT+NN+CEVVRG+ Sbjct: 338 KYPPCYKDMSFWINESFTENNLCEVVRGV 366