BLASTX nr result
ID: Glycyrrhiza30_contig00028257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00028257 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN36173.1 Pentatricopeptide repeat-containing protein, chloropl... 72 4e-12 XP_003516589.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 4e-12 OIV94760.1 hypothetical protein TanjilG_12973 [Lupinus angustifo... 70 2e-11 XP_019422034.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-11 XP_003611862.1 PPR containing protein [Medicago truncatula] AES9... 70 2e-11 XP_015964018.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 6e-11 KHN42035.1 Pentatricopeptide repeat-containing protein, mitochon... 67 2e-10 KRH28556.1 hypothetical protein GLYMA_11G061600 [Glycine max] 67 2e-10 XP_014519605.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 XP_017426774.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 XP_017416507.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-10 BAU01889.1 hypothetical protein VIGAN_11123300 [Vigna angularis ... 64 7e-10 XP_012574550.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 7e-10 XP_017434651.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 1e-09 KOM55772.1 hypothetical protein LR48_Vigan10g166400 [Vigna angul... 64 2e-09 XP_007156866.1 hypothetical protein PHAVU_002G024100g [Phaseolus... 62 1e-08 OAY33881.1 hypothetical protein MANES_13G132900 [Manihot esculenta] 61 2e-08 XP_012079120.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 6e-08 XP_010103685.1 hypothetical protein L484_011738 [Morus notabilis... 59 1e-07 XP_009379156.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 >KHN36173.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 616 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYIV+ G+EIDSI+TNALIDMY CGHLQ A+ VFDQMLD Sbjct: 209 VHLYIVITGVEIDSIVTNALIDMYAKCGHLQFAKHVFDQMLD 250 >XP_003516589.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Glycine max] KRH76907.1 hypothetical protein GLYMA_01G180600 [Glycine max] Length = 667 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYIV+ G+EIDSI+TNALIDMY CGHLQ A+ VFDQMLD Sbjct: 260 VHLYIVITGVEIDSIVTNALIDMYAKCGHLQFAKHVFDQMLD 301 >OIV94760.1 hypothetical protein TanjilG_12973 [Lupinus angustifolius] Length = 613 Score = 69.7 bits (169), Expect = 2e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VH+YI++ G+E DSI+TNALIDMY CGHLQCA+ VFD+M+D Sbjct: 211 VHIYIIITGIETDSIVTNALIDMYAKCGHLQCAKIVFDRMVD 252 >XP_019422034.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Lupinus angustifolius] Length = 662 Score = 69.7 bits (169), Expect = 2e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VH+YI++ G+E DSI+TNALIDMY CGHLQCA+ VFD+M+D Sbjct: 260 VHIYIIITGIETDSIVTNALIDMYAKCGHLQCAKIVFDRMVD 301 >XP_003611862.1 PPR containing protein [Medicago truncatula] AES94820.1 PPR containing protein [Medicago truncatula] Length = 663 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHL++VV G+EIDSI+TNAL+DMY CG+L+CA+SVFDQMLD Sbjct: 257 VHLHMVVTGIEIDSIVTNALMDMYAKCGNLKCAKSVFDQMLD 298 >XP_015964018.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Arachis duranensis] Length = 614 Score = 68.2 bits (165), Expect = 6e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 +HLYI+ G+ IDSI+TNALIDMY CGHLQ AE VFDQMLD Sbjct: 255 MHLYIIATGIAIDSIVTNALIDMYAKCGHLQYAERVFDQMLD 296 >KHN42035.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 570 Score = 67.0 bits (162), Expect = 2e-10 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQML--DFVRW 140 VHLYIV+ G+EIDSI+TNALIDMY C HLQ A+ VFD+ML D V W Sbjct: 250 VHLYIVITGVEIDSIVTNALIDMYAKCRHLQFAKHVFDRMLHKDVVSW 297 >KRH28556.1 hypothetical protein GLYMA_11G061600 [Glycine max] Length = 610 Score = 67.0 bits (162), Expect = 2e-10 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQML--DFVRW 140 VHLYIV+ G+EIDSI+TNALIDMY C HLQ A+ VFD+ML D V W Sbjct: 259 VHLYIVITGVEIDSIVTNALIDMYAKCRHLQFAKHVFDRMLHKDVVSW 306 >XP_014519605.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Vigna radiata var. radiata] Length = 667 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYIV ++IDSI+ NALIDMY CGHLQCA+ VFD+MLD Sbjct: 260 VHLYIVTTDVQIDSIVKNALIDMYAKCGHLQCAKRVFDRMLD 301 >XP_017426774.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Vigna angularis] KOM45080.1 hypothetical protein LR48_Vigan06g038600 [Vigna angularis] Length = 667 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYIV ++IDSI+ NALIDMY CGHLQCA+ VFD+MLD Sbjct: 260 VHLYIVTTDVQIDSIVKNALIDMYAKCGHLQCAKRVFDRMLD 301 >XP_017416507.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Vigna angularis] Length = 202 Score = 63.9 bits (154), Expect = 5e-10 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYIV ++IDSI+ NALIDMY CGH QCA+ VFD++LD Sbjct: 52 VHLYIVTTDVQIDSIVKNALIDMYAKCGHFQCAKCVFDRILD 93 >BAU01889.1 hypothetical protein VIGAN_11123300 [Vigna angularis var. angularis] Length = 200 Score = 63.5 bits (153), Expect = 7e-10 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQML--DFVRW 140 VHLYIV ++IDSI+ NALIDMY CGH QCA+ VFD+ML + V W Sbjct: 37 VHLYIVTTDVQIDSIVKNALIDMYAKCGHFQCAKCVFDRMLHKNVVSW 84 >XP_012574550.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cicer arietinum] Length = 652 Score = 65.1 bits (157), Expect = 7e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VH+YIVV G++ID I+TNAL+DMY CGHL+ A+ VFDQMLD Sbjct: 251 VHVYIVVTGIKIDLIVTNALVDMYAKCGHLKYAKCVFDQMLD 292 >XP_017434651.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Vigna angularis] Length = 317 Score = 63.9 bits (154), Expect = 1e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYIV ++IDSI+ NALIDMY CGH QCA+ VFD++LD Sbjct: 133 VHLYIVTTDVQIDSIVKNALIDMYAKCGHFQCAKCVFDRILD 174 >KOM55772.1 hypothetical protein LR48_Vigan10g166400 [Vigna angularis] Length = 509 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQML--DFVRW 140 VHLYIV ++IDSI+ NALIDMY CGH QCA+ VFD+ML + V W Sbjct: 193 VHLYIVTTDVQIDSIVKNALIDMYAKCGHFQCAKCVFDRMLHKNVVSW 240 >XP_007156866.1 hypothetical protein PHAVU_002G024100g [Phaseolus vulgaris] ESW28860.1 hypothetical protein PHAVU_002G024100g [Phaseolus vulgaris] Length = 667 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYI+ ++IDSI+TNALIDMY CG+LQ A+ VFD+MLD Sbjct: 260 VHLYIITTDVQIDSIVTNALIDMYGKCGNLQYAKRVFDRMLD 301 >OAY33881.1 hypothetical protein MANES_13G132900 [Manihot esculenta] Length = 657 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLYI + GMEID I+ NAL+DMY CG LQ AE VF++MLD Sbjct: 252 VHLYIEITGMEIDLIVRNALLDMYAKCGQLQSAERVFERMLD 293 >XP_012079120.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Jatropha curcas] Length = 657 Score = 59.7 bits (143), Expect = 6e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 +HL+I + G+EID I+ NAL+DMY CGHLQ AE +FDQM D Sbjct: 252 LHLHIEITGLEIDLIVRNALLDMYAKCGHLQLAERLFDQMSD 293 >XP_010103685.1 hypothetical protein L484_011738 [Morus notabilis] EXB96697.1 hypothetical protein L484_011738 [Morus notabilis] Length = 610 Score = 58.9 bits (141), Expect = 1e-07 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQMLD 128 VHLY+ + G+EID I+ NAL+DMY CG+LQ A+++FD+M D Sbjct: 211 VHLYVEISGIEIDQIVRNALLDMYAKCGNLQSAQTIFDRMSD 252 >XP_009379156.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Pyrus x bretschneideri] Length = 663 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +3 Query: 3 VHLYIVVPGMEIDSIMTNALIDMYPNCGHLQCAESVFDQM 122 VHL+I V G+EID I+ NAL+DMY CGHL A ++FDQM Sbjct: 261 VHLFIEVSGIEIDQIVRNALLDMYAKCGHLHMARTIFDQM 300