BLASTX nr result
ID: Glycyrrhiza30_contig00028186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00028186 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN06554.1 E3 ubiquitin-protein ligase RING1 [Glycine soja] 54 2e-06 KRH59281.1 hypothetical protein GLYMA_05G175400 [Glycine max] 54 2e-06 XP_006580255.1 PREDICTED: RING-H2 finger protein ATL52-like [Gly... 54 2e-06 XP_007159707.1 hypothetical protein PHAVU_002G260500g [Phaseolus... 52 8e-06 >KHN06554.1 E3 ubiquitin-protein ligase RING1 [Glycine soja] Length = 313 Score = 53.9 bits (128), Expect = 2e-06 Identities = 30/38 (78%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 285 LQKRPIST----RRSFSHSRKFLFSSRHCRSQSSTLPL 184 LQKRPIS RRSFSH+ KFLFS RHCRSQSSTLPL Sbjct: 277 LQKRPISVSMRMRRSFSHNTKFLFS-RHCRSQSSTLPL 313 >KRH59281.1 hypothetical protein GLYMA_05G175400 [Glycine max] Length = 339 Score = 53.9 bits (128), Expect = 2e-06 Identities = 30/38 (78%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 285 LQKRPIST----RRSFSHSRKFLFSSRHCRSQSSTLPL 184 LQKRPIS RRSFSH+ KFLFS RHCRSQSSTLPL Sbjct: 303 LQKRPISVSMRMRRSFSHNTKFLFS-RHCRSQSSTLPL 339 >XP_006580255.1 PREDICTED: RING-H2 finger protein ATL52-like [Glycine max] Length = 364 Score = 53.9 bits (128), Expect = 2e-06 Identities = 30/38 (78%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 285 LQKRPIST----RRSFSHSRKFLFSSRHCRSQSSTLPL 184 LQKRPIS RRSFSH+ KFLFS RHCRSQSSTLPL Sbjct: 328 LQKRPISVSMRMRRSFSHNTKFLFS-RHCRSQSSTLPL 364 >XP_007159707.1 hypothetical protein PHAVU_002G260500g [Phaseolus vulgaris] ESW31701.1 hypothetical protein PHAVU_002G260500g [Phaseolus vulgaris] Length = 352 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 285 LQKRPISTRRSFSHSRKFLFSSRHCRSQSSTLPL 184 LQK P+S RRSFSH+RKFLFS+ H RSQSSTLP+ Sbjct: 320 LQKGPVSMRRSFSHNRKFLFST-HSRSQSSTLPI 352