BLASTX nr result
ID: Glycyrrhiza30_contig00028088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00028088 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494087.1 PREDICTED: probable aquaporin TIP-type [Cicer ari... 55 8e-06 >XP_004494087.1 PREDICTED: probable aquaporin TIP-type [Cicer arietinum] Length = 250 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 307 NP*EATHPDTFKASLTGFISSFRAYFIGSGSSITYNKL 194 NP EATHPDT KA L FIS+F F GSGSSI YNKL Sbjct: 10 NPQEATHPDTLKAGLAEFISTFIFVFAGSGSSIAYNKL 47