BLASTX nr result
ID: Glycyrrhiza30_contig00027987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027987 (662 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016743906.1 PREDICTED: signal peptide peptidase-like [Gossypi... 56 8e-06 >XP_016743906.1 PREDICTED: signal peptide peptidase-like [Gossypium hirsutum] Length = 339 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 645 VVAFSATLLLYIKCFFLPKHWNEDTIIWHFPYLHS 541 ++A SAT+L IKCF LPKHWNED IIWHFP+ S Sbjct: 99 IIALSATILPTIKCF-LPKHWNEDLIIWHFPFFRS 132