BLASTX nr result
ID: Glycyrrhiza30_contig00027941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027941 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003615935.1 WRKY family transcription factor [Medicago trunca... 54 7e-07 >XP_003615935.1 WRKY family transcription factor [Medicago truncatula] AES98893.1 WRKY family transcription factor [Medicago truncatula] Length = 327 Score = 54.3 bits (129), Expect(2) = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 38 KKVERTMDGKVIETLYKGTHNHCKPMVTMER 130 KKVERT+DG+VIETLYKGTHNH KP +M+R Sbjct: 254 KKVERTIDGEVIETLYKGTHNHWKPTSSMKR 284 Score = 26.2 bits (56), Expect(2) = 7e-07 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 1 YYKCTKSNCPVRKK 42 YYKCT NC V+KK Sbjct: 242 YYKCTWPNCFVKKK 255