BLASTX nr result
ID: Glycyrrhiza30_contig00027940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027940 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_043768366.1 copper-binding protein [Methylobacterium extorquens] 75 4e-14 ACS44166.1 Copper resistance protein copA (plasmid) [Methylobact... 75 4e-14 WP_062315937.1 copper-binding protein [Bradyrhizobium sp. CCH10-C7] 64 7e-10 WP_048464880.1 copper-binding protein [Methylobacterium aquaticu... 62 2e-09 WP_066577215.1 copper-binding protein [Sphingomonas koreensis] 62 2e-09 WP_031448078.1 copper-binding protein [Caulobacteraceae bacteriu... 62 3e-09 WP_026150028.1 MULTISPECIES: copper-binding protein [Sphingobium... 61 4e-09 WP_040427209.1 MULTISPECIES: copper-binding protein [Bradyrhizob... 61 4e-09 WP_057196688.1 MULTISPECIES: copper-binding protein [Bradyrhizob... 61 5e-09 WP_057196799.1 MULTISPECIES: copper-binding protein [Bradyrhizob... 61 5e-09 WP_069625182.1 copper-binding protein [Methyloceanibacter margin... 61 6e-09 WP_037476093.1 copper-binding protein [Sphingobium sp. ba1] 61 6e-09 SCW89445.1 copper-resistance protein, CopA family [Sphingobium f... 61 6e-09 WP_029624733.1 copper-binding protein [Sphingomonas sp. KC8] 61 6e-09 WP_026109362.1 MULTISPECIES: copper-binding protein [Proteobacte... 61 6e-09 KFL47298.1 copper resistance protein CopA [Sphingobium sp. ba1] 61 6e-09 WP_070934442.1 copper-binding protein [Sphingomonas haloaromatic... 60 1e-08 WP_015457827.1 hypothetical protein [Sphingomonas sp. MM-1] AGH4... 60 1e-08 WP_037520660.1 MULTISPECIES: copper-binding protein [Sphingobium... 60 1e-08 SCW94490.1 copper-resistance protein, CopA family [Sphingobium f... 60 1e-08 >WP_043768366.1 copper-binding protein [Methylobacterium extorquens] Length = 620 Score = 75.5 bits (184), Expect = 4e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 156 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD Sbjct: 459 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 492 >ACS44166.1 Copper resistance protein copA (plasmid) [Methylobacterium extorquens AM1] Length = 679 Score = 75.5 bits (184), Expect = 4e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 156 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD Sbjct: 518 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 551 >WP_062315937.1 copper-binding protein [Bradyrhizobium sp. CCH10-C7] Length = 602 Score = 63.5 bits (153), Expect = 7e-10 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 156 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 +PQDRTG+PGLGL++ GHKVLTYRDL+ALKPN D Sbjct: 441 DPQDRTGHPGLGLKDVGHKVLTYRDLVALKPNRD 474 >WP_048464880.1 copper-binding protein [Methylobacterium aquaticum] KMO33358.1 copper-binding protein [Methylobacterium aquaticum] Length = 659 Score = 62.4 bits (150), Expect = 2e-09 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 156 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 +PQDRTG+PGLGL++ GHKVLTYRDL++LKPN D Sbjct: 498 DPQDRTGHPGLGLKDVGHKVLTYRDLVSLKPNRD 531 >WP_066577215.1 copper-binding protein [Sphingomonas koreensis] Length = 582 Score = 62.0 bits (149), Expect = 2e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PG+GL+N GHKVLTYRDLI+L PNPD Sbjct: 422 PVDRTGDPGIGLDNVGHKVLTYRDLISLTPNPD 454 >WP_031448078.1 copper-binding protein [Caulobacteraceae bacterium PMMR1] Length = 571 Score = 61.6 bits (148), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 PQDRTG PG GLE+ GH+VLTYRDL+AL+PNPD Sbjct: 411 PQDRTGEPGQGLESVGHRVLTYRDLMALEPNPD 443 >WP_026150028.1 MULTISPECIES: copper-binding protein [Sphingobium] KKW90457.1 copper-binding protein [Sphingobium chungbukense] ODU67312.1 copper-binding protein [Novosphingobium sp. SCN 66-18] OJY68338.1 copper-binding protein [Sphingobium sp. 66-54] Length = 580 Score = 61.2 bits (147), Expect = 4e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PG+GL+N GHKVLTYRDL++L PNPD Sbjct: 420 PVDRTGDPGVGLDNVGHKVLTYRDLVSLTPNPD 452 >WP_040427209.1 MULTISPECIES: copper-binding protein [Bradyrhizobiaceae] Length = 602 Score = 61.2 bits (147), Expect = 4e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 156 EPQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 +PQDRT +PGLGL++ GHKVLTYRDL+ALKPN D Sbjct: 441 DPQDRTSHPGLGLKDVGHKVLTYRDLVALKPNRD 474 >WP_057196688.1 MULTISPECIES: copper-binding protein [Bradyrhizobium] KQT20717.1 copper-binding protein [Bradyrhizobium sp. Leaf396] Length = 638 Score = 61.2 bits (147), Expect = 5e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 PQDRTG+PG+GLE+ GH+VLTYRDLIAL+ NPD Sbjct: 478 PQDRTGDPGMGLESVGHRVLTYRDLIALERNPD 510 >WP_057196799.1 MULTISPECIES: copper-binding protein [Bradyrhizobium] KQT20311.1 copper-binding protein [Bradyrhizobium sp. Leaf396] Length = 639 Score = 61.2 bits (147), Expect = 5e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 PQDRTG+PG+GLE+ GH+VLTYRDLIAL+ NPD Sbjct: 479 PQDRTGDPGMGLESVGHRVLTYRDLIALERNPD 511 >WP_069625182.1 copper-binding protein [Methyloceanibacter marginalis] ODR94867.1 copper-binding protein [Methyloceanibacter marginalis] Length = 591 Score = 60.8 bits (146), Expect = 6e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P+DRTG PGLGL+N GH+VLTYRDL++LKPN D Sbjct: 430 PKDRTGEPGLGLKNVGHRVLTYRDLVSLKPNKD 462 >WP_037476093.1 copper-binding protein [Sphingobium sp. ba1] Length = 599 Score = 60.8 bits (146), Expect = 6e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+ GHKVLTYRDL++L PNPD Sbjct: 439 PVDRTGDPGLGLEDVGHKVLTYRDLMSLTPNPD 471 >SCW89445.1 copper-resistance protein, CopA family [Sphingobium faniae] Length = 601 Score = 60.8 bits (146), Expect = 6e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+ GHKVLTYRDL++L PNPD Sbjct: 441 PVDRTGDPGLGLEDVGHKVLTYRDLMSLTPNPD 473 >WP_029624733.1 copper-binding protein [Sphingomonas sp. KC8] Length = 601 Score = 60.8 bits (146), Expect = 6e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+ GHKVLTYRDL++L PNPD Sbjct: 441 PVDRTGDPGLGLEDVGHKVLTYRDLMSLTPNPD 473 >WP_026109362.1 MULTISPECIES: copper-binding protein [Proteobacteria] KMW30394.1 copper-binding protein [Sphingobium yanoikuyae] OHD08536.1 copper-binding protein [Sphingopyxis sp. RIFCSPHIGHO2_12_FULL_65_19] Length = 609 Score = 60.8 bits (146), Expect = 6e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+ GHKVLTYRDL++L PNPD Sbjct: 449 PVDRTGDPGLGLEDVGHKVLTYRDLMSLTPNPD 481 >KFL47298.1 copper resistance protein CopA [Sphingobium sp. ba1] Length = 624 Score = 60.8 bits (146), Expect = 6e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+ GHKVLTYRDL++L PNPD Sbjct: 464 PVDRTGDPGLGLEDVGHKVLTYRDLMSLTPNPD 496 >WP_070934442.1 copper-binding protein [Sphingomonas haloaromaticamans] OHT21237.1 Copper resistance protein A precursor [Sphingomonas haloaromaticamans] Length = 575 Score = 60.1 bits (144), Expect = 1e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+AGHKVLTYRDL++L PN D Sbjct: 415 PVDRTGDPGLGLEDAGHKVLTYRDLVSLAPNAD 447 >WP_015457827.1 hypothetical protein [Sphingomonas sp. MM-1] AGH48812.1 CopA family copper-resistance protein [Sphingomonas sp. MM-1] Length = 579 Score = 60.1 bits (144), Expect = 1e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PGLGLE+AGHKVLTYRDL++L PN D Sbjct: 419 PVDRTGDPGLGLEDAGHKVLTYRDLVSLAPNAD 451 >WP_037520660.1 MULTISPECIES: copper-binding protein [Sphingobium] KEZ17928.1 Copper-binding protein [Sphingobium yanoikuyae] OAH42568.1 copper-binding protein [Sphingobium yanoikuyae] Length = 594 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PG+GLE+ GHKVLTYRDL++L PNPD Sbjct: 434 PADRTGDPGVGLEDVGHKVLTYRDLMSLTPNPD 466 >SCW94490.1 copper-resistance protein, CopA family [Sphingobium faniae] Length = 602 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 159 PQDRTGNPGLGLENAGHKVLTYRDLIALKPNPD 257 P DRTG+PG+GLE+ GHKVLTYRDL++L PNPD Sbjct: 442 PVDRTGDPGVGLEDVGHKVLTYRDLMSLSPNPD 474