BLASTX nr result
ID: Glycyrrhiza30_contig00027937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027937 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACS44167.1 Hypothetical protein MexAM1_p2METAp0031 (plasmid) [Me... 221 1e-71 WP_053611057.1 hypothetical protein [Streptomyces purpurogeneisc... 74 3e-13 ACL63226.1 putative transcriptional regulator, Crp/Fnr family (p... 68 3e-11 WP_012605232.1 cyclic nucleotide-binding protein [Methylobacteri... 66 3e-10 WP_015951520.1 cyclic nucleotide-binding protein [Methylobacteri... 66 3e-10 ACL60950.1 putative transcriptional regulator, Crp/Fnr family [M... 65 4e-10 WP_048437423.1 cyclic nucleotide-binding protein [Methylobacteri... 63 2e-09 WP_048452953.1 hypothetical protein [Methylobacterium tarhaniae]... 62 3e-09 SFN03077.1 cAMP-binding domain of CRP or a regulatory subunit of... 62 3e-09 SDO32097.1 cAMP-binding domain of CRP or a regulatory subunit of... 62 3e-09 WP_056277567.1 MULTISPECIES: hypothetical protein [Methylobacter... 62 4e-09 SFE89142.1 cAMP-binding domain of CRP or a regulatory subunit of... 62 5e-09 SEP30757.1 cAMP-binding domain of CRP or a regulatory subunit of... 62 5e-09 WP_060849067.1 cyclic nucleotide-binding protein [Methylobacteri... 62 5e-09 SDO43043.1 cAMP-binding domain of CRP or a regulatory subunit of... 62 5e-09 WP_056380768.1 hypothetical protein [Methylobacterium sp. Leaf46... 62 6e-09 SFV15708.1 cAMP-binding domain of CRP or a regulatory subunit of... 62 7e-09 WP_048435279.1 cyclic nucleotide-binding protein [Methylobacteri... 62 7e-09 WP_062014325.1 hypothetical protein [Aureimonas sp. AU4] 62 7e-09 BAQ49208.1 cAMP-binding proteins - catabolite gene activator and... 61 8e-09 >ACS44167.1 Hypothetical protein MexAM1_p2METAp0031 (plasmid) [Methylobacterium extorquens AM1] Length = 193 Score = 221 bits (562), Expect = 1e-71 Identities = 109/121 (90%), Positives = 109/121 (90%) Frame = -1 Query: 364 GGDPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIYLVMSGFACRYK 185 GGDPFLRKLERAGNLSEGERTALQTLTFNRRSVPA IYLVMSGFACRYK Sbjct: 11 GGDPFLRKLERAGNLSEGERTALQTLTFNRRSVPARRDITDGDTTDRIYLVMSGFACRYK 70 Query: 184 TLLGGNRRIVSFVLPGDLCYLHDKGGVTSGQQSAKDRPFKLRSAFCLFDIPPHCGKLPAG 5 TLLGGNRRIVSFVLPGDLCYLHDKGGVTSGQQSAKDRPFKLRSAFCLFDIPPHCGKLPAG Sbjct: 71 TLLGGNRRIVSFVLPGDLCYLHDKGGVTSGQQSAKDRPFKLRSAFCLFDIPPHCGKLPAG 130 Query: 4 T 2 T Sbjct: 131 T 131 >WP_053611057.1 hypothetical protein [Streptomyces purpurogeneiscleroticus] Length = 282 Score = 73.6 bits (179), Expect = 3e-13 Identities = 41/87 (47%), Positives = 47/87 (54%), Gaps = 5/87 (5%) Frame = -1 Query: 364 GGDPFLRK-----LERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIYLVMSGF 200 GGD LR LE AG LSE ER AL L F R+VP +L++SG Sbjct: 15 GGDELLRSRLVAGLEHAGRLSEVERKALYDLPFRTRAVPQRTDIDAGGTSQSAHLILSGI 74 Query: 199 ACRYKTLLGGNRRIVSFVLPGDLCYLH 119 ACRYK GG RRI+S +LPGD C H Sbjct: 75 ACRYKLWAGGARRIISLILPGDFCDGH 101 >ACL63226.1 putative transcriptional regulator, Crp/Fnr family (plasmid) [Methylobacterium nodulans ORS 2060] Length = 244 Score = 67.8 bits (164), Expect = 3e-11 Identities = 35/77 (45%), Positives = 46/77 (59%) Frame = -1 Query: 349 LRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIYLVMSGFACRYKTLLGG 170 +R+LE+AG LS E ALQ + R V A ++L++ GFACRYK GG Sbjct: 6 IRRLEQAGVLSGVEIKALQDVNLRERFVVARSDVYDNDFADNVHLILGGFACRYKIWAGG 65 Query: 169 NRRIVSFVLPGDLCYLH 119 NRRI+S ++PGDLC H Sbjct: 66 NRRIISLIVPGDLCDGH 82 >WP_012605232.1 cyclic nucleotide-binding protein [Methylobacterium extorquens] ACK81018.1 transcriptional regulator, Crp/Fnr family [Methylobacterium extorquens CM4] Length = 384 Score = 65.9 bits (159), Expect = 3e-10 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = -1 Query: 361 GDPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYK 185 G+P +RKLER LSE +R L+ ++ + R+VPA +LV+SGFACR+K Sbjct: 146 GNPLIRKLERFAMLSEADRALLEQISASPRTVPAGTDLVREGDEPDGVFLVLSGFACRHK 205 Query: 184 TLLGGNRRIVSFVLPGDLCYL 122 G R+I +++LPGDLC L Sbjct: 206 MRANGARQINAYLLPGDLCDL 226 >WP_015951520.1 cyclic nucleotide-binding protein [Methylobacterium extorquens] ACK84206.1 transcriptional regulator, Crp/Fnr family [Methylobacterium extorquens CM4] Length = 384 Score = 65.9 bits (159), Expect = 3e-10 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = -1 Query: 361 GDPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYK 185 G+P +RKLER LSE +R L+ ++ + R+VPA +LV+SGFACR+K Sbjct: 146 GNPLIRKLERFAMLSEADRALLEQISASPRTVPAGTDLVREGDEPDGVFLVLSGFACRHK 205 Query: 184 TLLGGNRRIVSFVLPGDLCYL 122 G R+I +++LPGDLC L Sbjct: 206 MRANGARQINAYLLPGDLCDL 226 >ACL60950.1 putative transcriptional regulator, Crp/Fnr family [Methylobacterium nodulans ORS 2060] Length = 244 Score = 64.7 bits (156), Expect = 4e-10 Identities = 34/77 (44%), Positives = 44/77 (57%) Frame = -1 Query: 349 LRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIYLVMSGFACRYKTLLGG 170 +R+LE AG LS E ALQ + R V A ++L++ GFACRYK G Sbjct: 6 IRRLEHAGVLSGVEIKALQDVNLRERFVVARSDVYDNDFADNVHLILGGFACRYKLWADG 65 Query: 169 NRRIVSFVLPGDLCYLH 119 NRRI+S ++PGDLC H Sbjct: 66 NRRIISLIVPGDLCDGH 82 >WP_048437423.1 cyclic nucleotide-binding protein [Methylobacterium platani] KMO10583.1 cyclic nucleotide-binding protein [Methylobacterium platani JCM 14648] Length = 255 Score = 63.2 bits (152), Expect = 2e-09 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKLE LSE + AL LT R VPA YL++ G+ACRYK Sbjct: 3 DALIRKLESFEELSEADHKALGALTLRIRKVPARTDLVSEGDPPNSVYLILDGYACRYKI 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I++F++PGD C L+ Sbjct: 63 LPDGQRQIMAFLVPGDFCDLN 83 >WP_048452953.1 hypothetical protein [Methylobacterium tarhaniae] KMO35584.1 hypothetical protein VQ03_21565 [Methylobacterium tarhaniae] Length = 234 Score = 62.4 bits (150), Expect = 3e-09 Identities = 35/77 (45%), Positives = 43/77 (55%) Frame = -1 Query: 349 LRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIYLVMSGFACRYKTLLGG 170 +R+LE AG LSE ER AL+ LT + + + L+MSG ACRYK G Sbjct: 7 IRRLEHAGPLSEAERDALRQLTLKPYCINSREDIDYKRSYHAVPLIMSGIACRYKLRPEG 66 Query: 169 NRRIVSFVLPGDLCYLH 119 RRIV F+LPGD LH Sbjct: 67 QRRIVHFLLPGDFYDLH 83 >SFN03077.1 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases [Methylobacterium pseudosasicola] Length = 239 Score = 62.4 bits (150), Expect = 3e-09 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKL +AG L+E + L+ ++ R VPA +LV+SGF CRYK Sbjct: 3 DTLIRKLSQAGGLTEADHKTLRQVSLRSRQVPARRDLTSEEDRPENVHLVLSGFVCRYKI 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R I + ++PGD C LH Sbjct: 63 LPKGQRHITALMVPGDFCDLH 83 >SDO32097.1 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases [Methylobacterium phyllostachyos] Length = 253 Score = 62.4 bits (150), Expect = 3e-09 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 +P KLE L++ +R LQ LT R + +LV+ GFACRYKT Sbjct: 3 NPLTMKLEYGARLTDEDRAVLQDLTTRTRRIARHVDISPEGERPENVHLVVEGFACRYKT 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L+ G R+I++F++PGD C LH Sbjct: 63 LIDGRRQILAFLVPGDFCDLH 83 >WP_056277567.1 MULTISPECIES: hypothetical protein [Methylobacterium] KQO63348.1 hypothetical protein ASF20_08115 [Methylobacterium sp. Leaf88] KQT71388.1 hypothetical protein ASG51_10620 [Methylobacterium sp. Leaf465] Length = 260 Score = 62.4 bits (150), Expect = 4e-09 Identities = 34/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 +PF++KL R LSE + AL++ + + R V A +L+ SGFACRYK Sbjct: 3 NPFIQKLGRRFALSESDEQALRSASAHLRGVHARTTLISEGDVPDHVHLIQSGFACRYKV 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L GG R IV+F++PGD C L+ Sbjct: 63 LPGGGRSIVAFLIPGDFCDLN 83 >SFE89142.1 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases [Methylobacterium sp. yr596] Length = 256 Score = 62.0 bits (149), Expect = 5e-09 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKLE L+E +R AL LT R VPA +L++ G+ACRYK Sbjct: 3 DALIRKLESFEELTEADREALSALTLRIRKVPARTDLISEGDPPNSVHLILDGYACRYKV 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I+++++PGD C L+ Sbjct: 63 LPDGQRQIMAYLVPGDFCDLN 83 >SEP30757.1 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases [Methylobacterium sp. ap11] Length = 256 Score = 62.0 bits (149), Expect = 5e-09 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKLE L+E +R AL LT R VPA +L++ G+ACRYK Sbjct: 3 DALIRKLESFEELTEADRKALSALTLRIRKVPARTDLISEGDPPNSVHLILDGYACRYKV 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I+++++PGD C L+ Sbjct: 63 LPDGQRQIMAYLVPGDFCDLN 83 >WP_060849067.1 cyclic nucleotide-binding protein [Methylobacterium aquaticum] BAQ48302.1 cyclic nucleotide-binding protein [Methylobacterium aquaticum] Length = 256 Score = 62.0 bits (149), Expect = 5e-09 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKLE L+E +R AL LT R VPA +L++ G+ACRYK Sbjct: 3 DALIRKLESFEELTEADREALSALTLRIRKVPARTDLISEGDPPNSVHLILDGYACRYKV 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I+++++PGD C L+ Sbjct: 63 LPDGQRQIMAYLVPGDFCDLN 83 >SDO43043.1 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases [Aureimonas jatrophae] Length = 258 Score = 62.0 bits (149), Expect = 5e-09 Identities = 35/81 (43%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 DPF+ KLE L EG+R L+ S+ A + +LV+SG+ACRYK Sbjct: 5 DPFILKLETFATLDEGDRDLLRDRCRRVVSLRAKEEIVQEGTDPQVVHLVLSGYACRYKI 64 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G+R+IV F+LPGD C LH Sbjct: 65 LADGSRQIVGFLLPGDFCDLH 85 >WP_056380768.1 hypothetical protein [Methylobacterium sp. Leaf465] KQT80013.1 hypothetical protein ASG51_05235 [Methylobacterium sp. Leaf465] Length = 247 Score = 61.6 bits (148), Expect = 6e-09 Identities = 32/86 (37%), Positives = 47/86 (54%) Frame = -1 Query: 355 PFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIYLVMSGFACRYKTLL 176 PFL KLE +G+ +R A+ ++ + R V A + +++ G CRY+ + Sbjct: 4 PFLTKLEHSGHTDAADRAAIASIVAHHRVVSARQDLSAEPGRSTVLVLLQGVMCRYRVMD 63 Query: 175 GGNRRIVSFVLPGDLCYLHDKGGVTS 98 G +RRI SFVLPGDLC L + TS Sbjct: 64 GRSRRIASFVLPGDLCRLPEAPPKTS 89 >SFV15708.1 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases [Methylobacterium sp. 174MFSha1.1] Length = 255 Score = 61.6 bits (148), Expect = 7e-09 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKLE L+E +R AL LT R VPA +L++ G+ACRYK Sbjct: 3 DALIRKLESFEELTEADRKALSALTLRIRRVPARTDLISEGDPPNSVHLILDGYACRYKV 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I+++++PGD C L+ Sbjct: 63 LPDGQRQIMAYLVPGDFCDLN 83 >WP_048435279.1 cyclic nucleotide-binding protein [Methylobacterium platani] KMO14749.1 cyclic nucleotide-binding protein [Methylobacterium platani JCM 14648] OAS23913.1 cyclic nucleotide-binding protein [Methylobacterium platani] Length = 255 Score = 61.6 bits (148), Expect = 7e-09 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 D +RKLE L+E +R AL LT R VPA +L++ G+ACRYK Sbjct: 3 DALIRKLESFEELTEADRKALSALTLRIRRVPARTDLISEGDPPNSVHLILDGYACRYKV 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I+++++PGD C L+ Sbjct: 63 LPDGQRQIMAYLVPGDFCDLN 83 >WP_062014325.1 hypothetical protein [Aureimonas sp. AU4] Length = 258 Score = 61.6 bits (148), Expect = 7e-09 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXI-YLVMSGFACRYKT 182 DPF+ KLE L EG+R L+ ++ A + +LV+SGFACRYK Sbjct: 5 DPFILKLETFAALDEGDRDLLRDRCRRIVAMRAKEEIVQEGADPQVVHLVLSGFACRYKI 64 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G+R+IV+F+LPGD C LH Sbjct: 65 LADGSRQIVAFLLPGDFCDLH 85 >BAQ49208.1 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (plasmid) [Methylobacterium aquaticum] Length = 242 Score = 61.2 bits (147), Expect = 8e-09 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = -1 Query: 358 DPFLRKLERAGNLSEGERTALQTLTFNRRSVPAXXXXXXXXXXXXIY-LVMSGFACRYKT 182 +P +RKLE LS+ +R L+ ++ R +P LVM GFACRYK Sbjct: 3 NPLIRKLEHGAPLSDDDRAVLEAISHKSRRIPTNHDIITEGTRPAAVNLVMRGFACRYKL 62 Query: 181 LLGGNRRIVSFVLPGDLCYLH 119 L G R+I +F++PGD C L+ Sbjct: 63 LSDGKRQITAFLVPGDFCDLN 83