BLASTX nr result
ID: Glycyrrhiza30_contig00027798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027798 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EJT04857.1 hypothetical protein RCCGE510_12016 [Rhizobium sp. CC... 57 4e-09 ACE91892.1 hypothetical protein RHECIAT_CH0002943 [Rhizobium etl... 56 1e-08 WP_039722461.1 hypothetical protein [Lyngbya confervoides] KIF44... 56 1e-08 CDX59431.1 hypothetical protein MPL3365_30631 [Mesorhizobium plu... 54 7e-08 CDX52279.1 hypothetical protein MPL1032_140306 [Mesorhizobium pl... 54 7e-08 KKZ86099.1 fused hypothetical protein/thymidylate synthase [Rhiz... 56 2e-07 CBI82463.1 conserved hypothetical protein [Bartonella schoenbuch... 49 5e-06 >EJT04857.1 hypothetical protein RCCGE510_12016 [Rhizobium sp. CCGE 510] Length = 98 Score = 57.4 bits (137), Expect = 4e-09 Identities = 30/59 (50%), Positives = 34/59 (57%) Frame = +1 Query: 1 GFWWRRRVPPPGPNGLLRRSFISIAGEPAPPI*RQSVRKTERIQADSGGKTHRFGLTSV 177 GFWWRRRVPPPGP GLL RSFI+IAG A AD GK H+ + S+ Sbjct: 27 GFWWRRRVPPPGPIGLLHRSFIAIAGPKA------GTGDIVVSSADGKGKRHKSVMPSI 79 >ACE91892.1 hypothetical protein RHECIAT_CH0002943 [Rhizobium etli CIAT 652] Length = 98 Score = 56.2 bits (134), Expect = 1e-08 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 1 GFWWRRRVPPPGPNGLLRRSFISIAGEPA 87 GFWWRRRVPPPGP GLL RSFI+IAG A Sbjct: 27 GFWWRRRVPPPGPIGLLHRSFIAIAGPKA 55 >WP_039722461.1 hypothetical protein [Lyngbya confervoides] KIF44404.1 hypothetical protein QQ91_00225 [Lyngbya confervoides BDU141951] Length = 103 Score = 56.2 bits (134), Expect = 1e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 98 YIGGAGSPAMEINDRRNKPFGPGGGTRRLHQ 6 Y+ GAGSPAM IN R NKP GPGGGTRRLHQ Sbjct: 49 YMEGAGSPAMAINGRYNKPIGPGGGTRRLHQ 79 >CDX59431.1 hypothetical protein MPL3365_30631 [Mesorhizobium plurifarium] Length = 98 Score = 54.3 bits (129), Expect = 7e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 1 GFWWRRRVPPPGPNGLLRRSFISIAGE 81 GFWWRRRVPPPGPNGL R FI+I G+ Sbjct: 30 GFWWRRRVPPPGPNGLFHRLFIAIVGQ 56 >CDX52279.1 hypothetical protein MPL1032_140306 [Mesorhizobium plurifarium] Length = 100 Score = 54.3 bits (129), Expect = 7e-08 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 1 GFWWRRRVPPPGPNGLLRRSFISIAGE 81 GFWWRRRVPPPGPNGL R FI+I G+ Sbjct: 32 GFWWRRRVPPPGPNGLFHRLFIAIVGQ 58 >KKZ86099.1 fused hypothetical protein/thymidylate synthase [Rhizobium phaseoli Ch24-10] Length = 370 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 1 GFWWRRRVPPPGPNGLLRRSFISIAGEPA 87 GFWWRRRVPPPGP GLL RSFI+IAG A Sbjct: 27 GFWWRRRVPPPGPIGLLHRSFIAIAGPKA 55 >CBI82463.1 conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 86 Score = 49.3 bits (116), Expect = 5e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +1 Query: 4 FWWRRRVPPPGPNGLLRRSFISIAGEPA 87 FWWRRRVPPPGP L FI+IAG+PA Sbjct: 27 FWWRRRVPPPGPMSLFHCPFITIAGKPA 54