BLASTX nr result
ID: Glycyrrhiza30_contig00027624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027624 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU10023.1 hypothetical protein TSUD_412650 [Trifolium subterran... 154 3e-43 XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing pr... 157 5e-43 XP_019464696.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 1e-40 XP_007155484.1 hypothetical protein PHAVU_003G205300g [Phaseolus... 149 3e-40 KOM32754.1 hypothetical protein LR48_Vigan01g231000 [Vigna angul... 147 2e-39 XP_017420755.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 2e-39 KHN18411.1 Pentatricopeptide repeat-containing protein, chloropl... 145 3e-39 KYP70216.1 hypothetical protein KK1_009427 [Cajanus cajan] 146 4e-39 XP_014490566.1 PREDICTED: pentatricopeptide repeat-containing pr... 143 6e-39 XP_003550712.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 6e-39 XP_013457737.1 PPR containing plant protein [Medicago truncatula... 145 1e-38 XP_014490582.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 XP_017418974.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 1e-37 XP_018809541.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 2e-37 XP_015970183.1 PREDICTED: pentatricopeptide repeat-containing pr... 141 2e-37 XP_018840083.1 PREDICTED: pentatricopeptide repeat-containing pr... 141 3e-37 XP_007155485.1 hypothetical protein PHAVU_003G205400g [Phaseolus... 140 4e-37 XP_016190144.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 4e-37 ONI08218.1 hypothetical protein PRUPE_5G165200 [Prunus persica] 137 4e-36 XP_008392892.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 6e-36 >GAU10023.1 hypothetical protein TSUD_412650 [Trifolium subterraneum] GAU10021.1 hypothetical protein TSUD_412630 [Trifolium subterraneum] Length = 455 Score = 154 bits (390), Expect = 3e-43 Identities = 76/96 (79%), Positives = 82/96 (85%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 LTKEIYDGIHR L A KFDEAENIVKTMR+AGYEPDN TY+ VV GLCKMKR EEA KV Sbjct: 193 LTKEIYDGIHRCLTNAEKFDEAENIVKTMRNAGYEPDNTTYNQVVFGLCKMKRVEEACKV 252 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 LEEMES GCIPD+ T SILI G+CAA+E+D ALLCL Sbjct: 253 LEEMESSGCIPDNKTWSILIQGHCAADELDKALLCL 288 >XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cicer arietinum] Length = 635 Score = 157 bits (396), Expect = 5e-43 Identities = 77/96 (80%), Positives = 82/96 (85%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 LTKEIYDGIHRSL A KFDEAE IVKTM +AG+EPD++TYS VV GLCKMKR EEA KV Sbjct: 372 LTKEIYDGIHRSLTSAGKFDEAEKIVKTMSNAGFEPDSVTYSQVVFGLCKMKRLEEAHKV 431 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 LE+ME CGCIPDSNT SILI GYCAANEVD AL CL Sbjct: 432 LEDMECCGCIPDSNTWSILIQGYCAANEVDKALHCL 467 >XP_019464696.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Lupinus angustifolius] OIW00303.1 hypothetical protein TanjilG_27554 [Lupinus angustifolius] Length = 620 Score = 150 bits (379), Expect = 1e-40 Identities = 74/95 (77%), Positives = 80/95 (84%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL KFDEAENIV+TMR+AG+EPDNITYS VV GLCKMKRFEEA KV Sbjct: 370 LSKAIYDGIHRSLTSVGKFDEAENIVQTMRNAGFEPDNITYSQVVFGLCKMKRFEEACKV 429 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEMES GCIPD T +ILI G+CA NEVD ALLC Sbjct: 430 LEEMESSGCIPDIKTWTILIQGHCAGNEVDKALLC 464 >XP_007155484.1 hypothetical protein PHAVU_003G205300g [Phaseolus vulgaris] ESW27478.1 hypothetical protein PHAVU_003G205300g [Phaseolus vulgaris] Length = 631 Score = 149 bits (376), Expect = 3e-40 Identities = 72/95 (75%), Positives = 82/95 (86%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL A KFDEAENIV+TMR+AG++PDNITYS VV GLCKM+RFEEA KV Sbjct: 367 LSKAIYDGIHRSLTGAGKFDEAENIVRTMRNAGHKPDNITYSQVVYGLCKMRRFEEACKV 426 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEMESCGCIPD T +ILI G+C ANE++ ALLC Sbjct: 427 LEEMESCGCIPDIKTWTILIQGHCDANELEKALLC 461 >KOM32754.1 hypothetical protein LR48_Vigan01g231000 [Vigna angularis] Length = 599 Score = 147 bits (370), Expect = 2e-39 Identities = 71/95 (74%), Positives = 81/95 (85%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL A KFDEAENIV+TMR+AG+EPDNITYS +V GLCKM+RFEEA KV Sbjct: 366 LSKAIYDGIHRSLTGAGKFDEAENIVRTMRNAGHEPDNITYSQLVFGLCKMRRFEEACKV 425 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEM+SCGCIPD T +ILI G+C A E+D ALLC Sbjct: 426 LEEMQSCGCIPDIKTWTILIQGHCDAMELDKALLC 460 >XP_017420755.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like isoform X1 [Vigna angularis] XP_017420836.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like isoform X2 [Vigna angularis] BAT76029.1 hypothetical protein VIGAN_01398200 [Vigna angularis var. angularis] Length = 630 Score = 147 bits (370), Expect = 2e-39 Identities = 71/95 (74%), Positives = 81/95 (85%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL A KFDEAENIV+TMR+AG+EPDNITYS +V GLCKM+RFEEA KV Sbjct: 366 LSKAIYDGIHRSLTGAGKFDEAENIVRTMRNAGHEPDNITYSQLVFGLCKMRRFEEACKV 425 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEM+SCGCIPD T +ILI G+C A E+D ALLC Sbjct: 426 LEEMQSCGCIPDIKTWTILIQGHCDAMELDKALLC 460 >KHN18411.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 545 Score = 145 bits (367), Expect = 3e-39 Identities = 71/95 (74%), Positives = 80/95 (84%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL A FDEAENIV+TMR+AGYEPDNITYS +V GLCKM+RFEEA KV Sbjct: 279 LSKAIYDGIHRSLTSAGNFDEAENIVRTMRNAGYEPDNITYSQMVFGLCKMRRFEEACKV 338 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LE+MES CIPD T +ILI G+C+ANEVD ALLC Sbjct: 339 LEDMESSRCIPDIKTWTILIQGHCSANEVDKALLC 373 >KYP70216.1 hypothetical protein KK1_009427 [Cajanus cajan] Length = 624 Score = 146 bits (368), Expect = 4e-39 Identities = 71/95 (74%), Positives = 80/95 (84%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHR L A KFDEAENIV+TMR+AG+EPDNITYS +V GLCKM+RFEEA+KV Sbjct: 362 LSKAIYDGIHRCLTGAGKFDEAENIVRTMRNAGHEPDNITYSQLVFGLCKMRRFEEAYKV 421 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEMESCGCIPD T +ILI G+ NEVD ALLC Sbjct: 422 LEEMESCGCIPDIKTWTILIQGHYDGNEVDKALLC 456 >XP_014490566.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vigna radiata var. radiata] Length = 451 Score = 143 bits (361), Expect = 6e-39 Identities = 66/96 (68%), Positives = 78/96 (81%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL + K DEAE+IV MR AG+EPDNITY V+ G CKM+R EEA KV Sbjct: 193 LSKAIYDGIHRSLTNSGKLDEAEDIVNLMRKAGHEPDNITYGQVIVGFCKMRRLEEACKV 252 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 +EEMESCGCIPD+NT ++L+ G+C ANEVD ALLCL Sbjct: 253 MEEMESCGCIPDTNTWTLLVQGHCVANEVDRALLCL 288 >XP_003550712.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Glycine max] KRH03217.1 hypothetical protein GLYMA_17G084400 [Glycine max] Length = 635 Score = 145 bits (367), Expect = 6e-39 Identities = 71/95 (74%), Positives = 80/95 (84%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL A FDEAENIV+TMR+AGYEPDNITYS +V GLCKM+RFEEA KV Sbjct: 369 LSKAIYDGIHRSLTSAGNFDEAENIVRTMRNAGYEPDNITYSQMVFGLCKMRRFEEACKV 428 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LE+MES CIPD T +ILI G+C+ANEVD ALLC Sbjct: 429 LEDMESSRCIPDIKTWTILIQGHCSANEVDKALLC 463 >XP_013457737.1 PPR containing plant protein [Medicago truncatula] KEH31768.1 PPR containing plant protein [Medicago truncatula] Length = 628 Score = 145 bits (365), Expect = 1e-38 Identities = 71/96 (73%), Positives = 78/96 (81%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 LTKEIYDGIHR L KFD+AENIVKTMR+ G+EPDN TYS +V GLCKMKR EEA KV Sbjct: 368 LTKEIYDGIHRCLTSVGKFDKAENIVKTMRNGGHEPDNTTYSQLVFGLCKMKRVEEACKV 427 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 LEEMES GCIPD+ T SI I G+CAAN +D ALLCL Sbjct: 428 LEEMESSGCIPDNKTWSIFIQGHCAANALDKALLCL 463 >XP_014490582.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vigna radiata var. radiata] Length = 630 Score = 144 bits (363), Expect = 2e-38 Identities = 69/95 (72%), Positives = 81/95 (85%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL A KFDEAE+IV+TMR+AG+EPDNIT+S +V GLCKM+RFEEA KV Sbjct: 366 LSKAIYDGIHRSLTGAGKFDEAESIVRTMRNAGHEPDNITFSQLVFGLCKMRRFEEACKV 425 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEM+SCGCIPD T +ILI G+C A E+D ALLC Sbjct: 426 LEEMQSCGCIPDIKTWTILIQGHCDAKELDKALLC 460 >XP_017418974.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vigna angularis] KOM32753.1 hypothetical protein LR48_Vigan01g230900 [Vigna angularis] BAT76028.1 hypothetical protein VIGAN_01398100 [Vigna angularis var. angularis] Length = 631 Score = 142 bits (358), Expect = 1e-37 Identities = 66/96 (68%), Positives = 76/96 (79%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L K IYDGIHRSL + K DEAENIV MR AG+EPDNITY V+ G CKM+R EEA KV Sbjct: 373 LPKAIYDGIHRSLTNSGKLDEAENIVNRMRKAGHEPDNITYGQVIVGFCKMRRLEEACKV 432 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 +EEMESCGCIPD+ T ++L+ G+C ANEVD ALLCL Sbjct: 433 MEEMESCGCIPDTKTWTLLVQGHCVANEVDRALLCL 468 >XP_018809541.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like, partial [Juglans regia] Length = 381 Score = 138 bits (347), Expect = 2e-37 Identities = 65/96 (67%), Positives = 78/96 (81%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K +YDGIHRSL A +FDEAEN++K MR+AGY PDNITYS VV GLCK RFE+A KV Sbjct: 122 LSKAVYDGIHRSLTNAGRFDEAENVMKVMRNAGYPPDNITYSQVVFGLCKTSRFEKACKV 181 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 L+EME+ GC+PD T +ILI G CAANEV+ AL+CL Sbjct: 182 LDEMEAQGCLPDIKTWTILIQGLCAANEVEKALMCL 217 >XP_015970183.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] XP_015970188.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] Length = 643 Score = 141 bits (356), Expect = 2e-37 Identities = 67/95 (70%), Positives = 78/95 (82%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L K IYDG+HRSL A KFDEAE IV +MR++GYEPDN+T+S +V GLCKM R EEA KV Sbjct: 380 LPKAIYDGVHRSLAGAGKFDEAETIVGSMRNSGYEPDNVTFSQMVFGLCKMGRLEEACKV 439 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEMESCGCIPD T +ILI G+C+ANE+D ALLC Sbjct: 440 LEEMESCGCIPDIKTWTILIRGHCSANEIDKALLC 474 >XP_018840083.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Juglans regia] Length = 626 Score = 141 bits (355), Expect = 3e-37 Identities = 66/96 (68%), Positives = 80/96 (83%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K +YDGIHRSL A +FDEAENI+K MR+AGY+PDNITYS VV GLCKM+R EEA KV Sbjct: 367 LSKAVYDGIHRSLTSAGRFDEAENIMKVMRNAGYQPDNITYSQVVFGLCKMRRLEEACKV 426 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 L+EME GC+PD T +ILI G+CAANE++ AL+CL Sbjct: 427 LDEMEEQGCLPDIKTWTILIQGHCAANELEKALMCL 462 >XP_007155485.1 hypothetical protein PHAVU_003G205400g [Phaseolus vulgaris] ESW27479.1 hypothetical protein PHAVU_003G205400g [Phaseolus vulgaris] Length = 636 Score = 140 bits (354), Expect = 4e-37 Identities = 65/96 (67%), Positives = 78/96 (81%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K IYDGIHRSL + K DEAE+IV MR+AG+EPDNITY V+ G CKM+R EEA KV Sbjct: 373 LSKAIYDGIHRSLASSGKLDEAEDIVNRMRNAGHEPDNITYGQVIVGFCKMRRLEEACKV 432 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLCL 290 LE+MESCGCIPD+ T ++L+ GYC A+EVD ALLCL Sbjct: 433 LEDMESCGCIPDTKTWTLLVQGYCVASEVDKALLCL 468 >XP_016190144.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] XP_016190153.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] Length = 643 Score = 140 bits (354), Expect = 4e-37 Identities = 67/95 (70%), Positives = 78/95 (82%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L K IYDG+HRSL A KFDEAE IV +MR++GYEPDN+T+S +V GLCKM R EEA KV Sbjct: 380 LPKAIYDGVHRSLAGAGKFDEAETIVGSMRNSGYEPDNVTFSQMVFGLCKMGRLEEACKV 439 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEMESCGCIPD T +ILI G+C+ANE+D ALLC Sbjct: 440 LEEMESCGCIPDIKTWTILIRGHCSANEMDKALLC 474 >ONI08218.1 hypothetical protein PRUPE_5G165200 [Prunus persica] Length = 565 Score = 137 bits (345), Expect = 4e-36 Identities = 66/95 (69%), Positives = 76/95 (80%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K +YDGIHRSL A FDEAE I K MR+AGYEPDNITYS +V GLCK KR EEA KV Sbjct: 306 LSKAVYDGIHRSLTSAGSFDEAEKITKVMRNAGYEPDNITYSQLVFGLCKAKRLEEACKV 365 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 L+EME+ GC+PD T +ILI G+CAANEVD AL+C Sbjct: 366 LDEMEANGCVPDIMTWTILIQGHCAANEVDTALVC 400 >XP_008392892.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Malus domestica] Length = 658 Score = 137 bits (346), Expect = 6e-36 Identities = 65/95 (68%), Positives = 77/95 (81%) Frame = +3 Query: 3 LTKEIYDGIHRSLIRARKFDEAENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKV 182 L+K +YDGIHRSL A +FDEAE I+K MR+AGYEPDNITYS +V GLCK KR EEA V Sbjct: 368 LSKPVYDGIHRSLTGAGRFDEAEEIMKVMRNAGYEPDNITYSQLVFGLCKAKRLEEACNV 427 Query: 183 LEEMESCGCIPDSNTRSILIHGYCAANEVDNALLC 287 LEEME+ GC+PD T +ILI G+CAA+EVD AL+C Sbjct: 428 LEEMEADGCVPDIKTWTILIQGHCAABEVDTALIC 462