BLASTX nr result
ID: Glycyrrhiza30_contig00027583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027583 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573510.1 PREDICTED: zinc finger BED domain-containing prot... 64 4e-09 XP_012573509.1 PREDICTED: zinc finger BED domain-containing prot... 64 4e-09 XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus... 63 1e-08 XP_016199355.1 PREDICTED: zinc finger BED domain-containing prot... 62 2e-08 XP_015935840.1 PREDICTED: zinc finger BED domain-containing prot... 60 1e-07 XP_014621065.1 PREDICTED: zinc finger BED domain-containing prot... 59 3e-07 KHN03605.1 Putative AC transposase [Glycine soja] 59 3e-07 XP_014625130.1 PREDICTED: zinc finger BED domain-containing prot... 56 2e-06 KHN15060.1 Putative AC transposase [Glycine soja] 56 2e-06 XP_014508793.1 PREDICTED: zinc finger BED domain-containing prot... 55 6e-06 GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterran... 55 8e-06 >XP_012573510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573512.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] Length = 1058 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 7/56 (12%) Frame = +1 Query: 301 DFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 D +PSNDLAN +EN E QPN+D S+S AEP+KG PTSELQ SGGDA+ G Sbjct: 23 DIKPSNDLANSENQSDSNMENLEFQPNQDRSDSTAEPEKGHPTSELQASGGDANGG 78 >XP_012573509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X1 [Cicer arietinum] Length = 1066 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 7/56 (12%) Frame = +1 Query: 301 DFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 D +PSNDLAN +EN E QPN+D S+S AEP+KG PTSELQ SGGDA+ G Sbjct: 31 DIKPSNDLANSENQSDSNMENLEFQPNQDRSDSTAEPEKGHPTSELQASGGDANGG 86 >XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] ESW27042.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] Length = 1252 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = +1 Query: 295 SADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGD 435 S DFQPSNDL N VE SEPQP+KDLSN +AEP+K LP SE+Q S G+ Sbjct: 21 STDFQPSNDLVNSENQSDHSVEISEPQPDKDLSNFQAEPNKVLPASEIQASSGN 74 >XP_016199355.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] XP_016199363.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] Length = 1077 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/58 (56%), Positives = 42/58 (72%), Gaps = 7/58 (12%) Frame = +1 Query: 295 SADFQPSNDLA-------NYVENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 +AD QP+NDLA + VE+SEPQPNKDLS+S+ EP+K LP SE QV+ DA+ G Sbjct: 21 NADPQPTNDLAKSKTQPESTVEDSEPQPNKDLSDSKTEPEKVLPASESQVTSDDANTG 78 >XP_015935840.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] XP_015935843.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] Length = 1088 Score = 60.1 bits (144), Expect = 1e-07 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 7/56 (12%) Frame = +1 Query: 295 SADFQPSNDLA-------NYVENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDAS 441 +AD QP+NDLA + VE+SEPQPNKDLS+S+ EP+K LP SE QV+ DA+ Sbjct: 21 NADPQPTNDLAKSKTQPESTVEDSEPQPNKDLSDSKTEPEKVLPASESQVTSDDAN 76 >XP_014621065.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621066.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621067.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20154.1 hypothetical protein GLYMA_13G160000 [Glycine max] Length = 1180 Score = 58.9 bits (141), Expect = 3e-07 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = +1 Query: 295 SADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 S DFQPSNDLAN VENSE QPNKDLS+S+AE LP SE Q S DA+ G Sbjct: 21 STDFQPSNDLANSENQSDHNVENSESQPNKDLSSSKAEV---LPASETQASSADANEG 75 >KHN03605.1 Putative AC transposase [Glycine soja] Length = 1180 Score = 58.9 bits (141), Expect = 3e-07 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = +1 Query: 295 SADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 S DFQPSNDLAN VENSE QPNKDLS+S+AE LP SE Q S DA+ G Sbjct: 21 STDFQPSNDLANSENQSDHNVENSESQPNKDLSSSKAEV---LPASETQASSADANEG 75 >XP_014625130.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014625131.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH03658.1 hypothetical protein GLYMA_17G111500 [Glycine max] Length = 1154 Score = 56.2 bits (134), Expect = 2e-06 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = +1 Query: 295 SADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 + DF PSNDLAN VENSE QP+KDLS+S+AE LP SE Q S GDA+ G Sbjct: 21 TTDFDPSNDLANLKNQSDHNVENSESQPDKDLSSSKAEV---LPESETQASSGDANEG 75 >KHN15060.1 Putative AC transposase [Glycine soja] Length = 1154 Score = 56.2 bits (134), Expect = 2e-06 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = +1 Query: 295 SADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDASAG 447 + DF PSNDLAN VENSE QP+KDLS+S+AE LP SE Q S GDA+ G Sbjct: 21 TTDFDPSNDLANLKNQSDHNVENSESQPDKDLSSSKAEV---LPESETQASSGDANEG 75 >XP_014508793.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] XP_014508794.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] Length = 1233 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 7/54 (12%) Frame = +1 Query: 295 SADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGD 435 S FQPSNDL N VE SEPQP+KD SNS+AEP+K L SE+Q G+ Sbjct: 20 STGFQPSNDLVNSENQSDHNVEISEPQPDKDFSNSQAEPNKVLVASEVQAPSGN 73 >GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterraneum] Length = 912 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 7/57 (12%) Frame = +1 Query: 292 TSADFQPSNDLANY-------VENSEPQPNKDLSNSEAEPDKGLPTSELQVSGGDAS 441 +S D +PS+DL N ENSE QP KDL NSEA P++ L TSE +GGDA+ Sbjct: 45 SSTDSEPSSDLGNSKILSNNNAENSESQPTKDLCNSEAHPNEELSTSETHATGGDAN 101