BLASTX nr result
ID: Glycyrrhiza30_contig00027529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00027529 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493506.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 79 1e-15 XP_004513765.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 76 2e-14 XP_019444080.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 75 3e-14 XP_007145606.1 hypothetical protein PHAVU_007G253000g [Phaseolus... 75 4e-14 KYP63282.1 Zinc finger AN1 and C2H2 domain-containing stress-ass... 74 5e-14 GAU24257.1 hypothetical protein TSUD_23930 [Trifolium subterraneum] 74 7e-14 XP_003519070.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 74 8e-14 XP_013449626.1 zinc finger AN1 and C2H2 domain stress-associated... 74 9e-14 XP_016204987.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 73 2e-13 XP_015969517.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 73 2e-13 NP_001239954.1 uncharacterized protein LOC100806459 [Glycine max... 73 2e-13 XP_010057230.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 73 2e-13 OAY73065.1 Zinc finger AN1 and C2H2 domain-containing stress-ass... 69 4e-13 JAT42246.1 Zinc finger AN1 and C2H2 domain-containing stress-ass... 72 8e-13 XP_003535903.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 71 1e-12 ACU23624.1 unknown [Glycine max] 71 1e-12 GAV57299.1 zf-AN1 domain-containing protein/zf-C2H2_6 domain-con... 71 1e-12 KHN07378.1 Zinc finger AN1 and C2H2 domain-containing stress-ass... 71 1e-12 XP_014512245.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 71 2e-12 XP_017412667.1 PREDICTED: zinc finger AN1 and C2H2 domain-contai... 71 2e-12 >XP_004493506.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11 [Cicer arietinum] XP_004493507.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11 [Cicer arietinum] XP_012569287.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11 [Cicer arietinum] Length = 255 Score = 78.6 bits (192), Expect = 1e-15 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCAVSHC+LIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCAVSHCRLIDFLPFTCDRCNQ 33 >XP_004513765.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Cicer arietinum] Length = 289 Score = 76.3 bits (186), Expect = 2e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCAVS CKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDRCNQ 33 >XP_019444080.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Lupinus angustifolius] Length = 279 Score = 75.5 bits (184), Expect = 3e-14 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC++ HCKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCSLPHCKLIDFLPFTCDRCNQ 33 >XP_007145606.1 hypothetical protein PHAVU_007G253000g [Phaseolus vulgaris] ESW17600.1 hypothetical protein PHAVU_007G253000g [Phaseolus vulgaris] Length = 285 Score = 75.1 bits (183), Expect = 4e-14 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+VS CKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCSVSDCKLIDFLPFTCDRCNQ 33 >KYP63282.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13 [Cajanus cajan] Length = 242 Score = 74.3 bits (181), Expect = 5e-14 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCAVS CKLIDFLPFTCDRC+Q Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDRCDQ 33 >GAU24257.1 hypothetical protein TSUD_23930 [Trifolium subterraneum] Length = 275 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCA S CKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCAFSDCKLIDFLPFTCDRCNQ 33 >XP_003519070.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Glycine max] KHM99813.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16 [Glycine soja] KRH71980.1 hypothetical protein GLYMA_02G183100 [Glycine max] KRH71981.1 hypothetical protein GLYMA_02G183100 [Glycine max] KRH71982.1 hypothetical protein GLYMA_02G183100 [Glycine max] Length = 281 Score = 74.3 bits (181), Expect = 8e-14 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCAVS CKLIDFLPFTCDRC+Q Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDRCDQ 33 >XP_013449626.1 zinc finger AN1 and C2H2 domain stress-associated protein [Medicago truncatula] KEH23654.1 zinc finger AN1 and C2H2 domain stress-associated protein [Medicago truncatula] Length = 268 Score = 73.9 bits (180), Expect = 9e-14 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+VS C+LIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCSVSDCRLIDFLPFTCDRCNQ 33 >XP_016204987.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11 [Arachis ipaensis] Length = 291 Score = 73.2 bits (178), Expect = 2e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFP+LGKHC+VS CKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPNLGKHCSVSDCKLIDFLPFTCDRCNQ 33 >XP_015969517.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11-like [Arachis duranensis] Length = 291 Score = 73.2 bits (178), Expect = 2e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFP+LGKHC+VS CKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPNLGKHCSVSDCKLIDFLPFTCDRCNQ 33 >NP_001239954.1 uncharacterized protein LOC100806459 [Glycine max] ACU20053.1 unknown [Glycine max] KRH66953.1 hypothetical protein GLYMA_03G137500 [Glycine max] Length = 292 Score = 73.2 bits (178), Expect = 2e-13 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+VS+CK +DFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCSVSYCKQLDFLPFTCDRCNQ 33 >XP_010057230.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16 [Eucalyptus grandis] KCW90196.1 hypothetical protein EUGRSUZ_A02369 [Eucalyptus grandis] Length = 297 Score = 73.2 bits (178), Expect = 2e-13 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC V CKLIDFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCTVDDCKLIDFLPFTCDRCNQ 33 >OAY73065.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13 [Ananas comosus] Length = 122 Score = 69.3 bits (168), Expect = 4e-13 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+V CK IDFLPFTCDRC+Q Sbjct: 76 MGTPEFPDLGKHCSVDDCKQIDFLPFTCDRCSQ 108 >JAT42246.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16 [Anthurium amnicola] JAT67094.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16 [Anthurium amnicola] Length = 289 Score = 71.6 bits (174), Expect = 8e-13 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFP+LGKHC+V HC+ IDFLPFTCDRCNQ Sbjct: 1 MGTPEFPNLGKHCSVGHCRQIDFLPFTCDRCNQ 33 >XP_003535903.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Glycine max] KHN08871.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16 [Glycine soja] KRH33165.1 hypothetical protein GLYMA_10G103400 [Glycine max] Length = 278 Score = 71.2 bits (173), Expect = 1e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCAVS CKLIDFLPFTCD C+Q Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDCCDQ 33 >ACU23624.1 unknown [Glycine max] Length = 278 Score = 71.2 bits (173), Expect = 1e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHCAVS CKLIDFLPFTCD C+Q Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDCCDQ 33 >GAV57299.1 zf-AN1 domain-containing protein/zf-C2H2_6 domain-containing protein [Cephalotus follicularis] Length = 292 Score = 71.2 bits (173), Expect = 1e-12 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC V CKLIDFLPFTCDRC Q Sbjct: 1 MGTPEFPDLGKHCTVDECKLIDFLPFTCDRCTQ 33 >KHN07378.1 Zinc finger AN1 and C2H2 domain-containing stress-associated protein 11 [Glycine soja] Length = 292 Score = 71.2 bits (173), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+VS CK +DFLPFTCDRCNQ Sbjct: 1 MGTPEFPDLGKHCSVSCCKQLDFLPFTCDRCNQ 33 >XP_014512245.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Vigna radiata var. radiata] Length = 285 Score = 70.9 bits (172), Expect = 2e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+VS CK IDFLPFTCDRC+Q Sbjct: 1 MGTPEFPDLGKHCSVSDCKQIDFLPFTCDRCHQ 33 >XP_017412667.1 PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Vigna angularis] KOM34209.1 hypothetical protein LR48_Vigan02g035900 [Vigna angularis] BAT96368.1 hypothetical protein VIGAN_08329700 [Vigna angularis var. angularis] Length = 285 Score = 70.9 bits (172), Expect = 2e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 99 MGTPEFPDLGKHCAVSHCKLIDFLPFTCDRCNQ 1 MGTPEFPDLGKHC+VS CK IDFLPFTCDRC+Q Sbjct: 1 MGTPEFPDLGKHCSVSDCKQIDFLPFTCDRCHQ 33