BLASTX nr result
ID: Glycyrrhiza30_contig00026870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00026870 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19304.1 hypothetical protein TSUD_335900 [Trifolium subterran... 64 6e-17 OMP12411.1 hypothetical protein COLO4_03245 [Corchorus olitorius... 77 5e-16 >GAU19304.1 hypothetical protein TSUD_335900 [Trifolium subterraneum] Length = 62 Score = 64.3 bits (155), Expect(2) = 6e-17 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 269 MEFRLKSARHRVRGLQKVEWIKRRGRLGRQ 180 MEFRLKSARHRVRGLQKVEWIKRRGRLGRQ Sbjct: 1 MEFRLKSARHRVRGLQKVEWIKRRGRLGRQ 30 Score = 50.4 bits (119), Expect(2) = 6e-17 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = -1 Query: 198 RSTRAPTKGQRDK-EPPAAPPSFPGSLPVRTTRREGI 91 R R PTKG R K + APPSFPGSLPV+TTRREGI Sbjct: 26 RLGRQPTKGGRPKRQRTTAPPSFPGSLPVKTTRREGI 62 >OMP12411.1 hypothetical protein COLO4_03245 [Corchorus olitorius] OMP13429.1 hypothetical protein COLO4_01706 [Corchorus olitorius] Length = 154 Score = 77.4 bits (189), Expect = 5e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 ASYIYWTRRKYKLSCSMHGFDVFFCLNSTRSLPA 104 ASYIYWTRRKYKLSCSMHGFDVFFCLNSTRSLPA Sbjct: 121 ASYIYWTRRKYKLSCSMHGFDVFFCLNSTRSLPA 154