BLASTX nr result
ID: Glycyrrhiza30_contig00026766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00026766 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507153.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 2e-15 XP_013456164.1 PPR containing plant-like protein [Medicago trunc... 64 4e-10 XP_003537970.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-08 XP_019454098.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 7e-08 KYP37127.1 Pentatricopeptide repeat-containing protein At3g46870... 54 1e-06 XP_006591821.1 PREDICTED: uncharacterized protein LOC100306428 i... 52 7e-06 >XP_004507153.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cicer arietinum] Length = 261 Score = 77.8 bits (190), Expect = 2e-15 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 5/68 (7%) Frame = +1 Query: 70 MASRCFMKKWEIRRLASVYLGEFV--STRSSKPIRDASTPLMPSRP---FQCRRLWGFRE 234 MASRCFM+KWE RLASV+L E STR S IRD ST L + F+ + +WGFRE Sbjct: 1 MASRCFMRKWETCRLASVFLTELTSNSTRCSNLIRDVSTALSSTHSIAMFEPKSVWGFRE 60 Query: 235 YHDGRPRG 258 YHDGRPRG Sbjct: 61 YHDGRPRG 68 >XP_013456164.1 PPR containing plant-like protein [Medicago truncatula] KEH30195.1 PPR containing plant-like protein [Medicago truncatula] Length = 261 Score = 63.5 bits (153), Expect = 4e-10 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 5/68 (7%) Frame = +1 Query: 70 MASRCFMKKWEIRRLASVYLGEFVS--TRSSKPIRDASTPLMPSR---PFQCRRLWGFRE 234 MA RC ++KW+ RL S +L +F S T++ PIRD S+ L + F+ + + GFRE Sbjct: 1 MALRCILRKWKTHRLTSSFLTQFTSNPTKTINPIRDISSALSSTHFITSFEHKNVTGFRE 60 Query: 235 YHDGRPRG 258 YHDGRPRG Sbjct: 61 YHDGRPRG 68 >XP_003537970.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Glycine max] KRH29734.1 hypothetical protein GLYMA_11G135100 [Glycine max] Length = 255 Score = 59.3 bits (142), Expect = 1e-08 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +1 Query: 70 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQC-RRLWGFREYHDG 246 MASR F+K W+I AS+ LGEF TRS KPI+D S+ + F + FR+YHDG Sbjct: 1 MASRSFLKNWKILDFASLLLGEF--TRSIKPIKDVSSTSLTFVEFNSFKTALCFRQYHDG 58 Query: 247 RPRG 258 RPRG Sbjct: 59 RPRG 62 >XP_019454098.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Lupinus angustifolius] XP_019454099.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Lupinus angustifolius] OIW05740.1 hypothetical protein TanjilG_23526 [Lupinus angustifolius] Length = 254 Score = 57.4 bits (137), Expect = 7e-08 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 70 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRL-WGFREYHDG 246 MA+R F KKW L S +L + TR+ PI+ +S+ FQC+ + WG REYHDG Sbjct: 1 MATRSFFKKWRFPHLVSPFLNQL--TRTPNPIKQSSST-SDVAVFQCKTVSWGLREYHDG 57 Query: 247 RPRG 258 RPRG Sbjct: 58 RPRG 61 >KYP37127.1 Pentatricopeptide repeat-containing protein At3g46870 family [Cajanus cajan] Length = 257 Score = 53.9 bits (128), Expect = 1e-06 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Frame = +1 Query: 70 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDAST--PLMP-SRPFQCRRLWGFREYH 240 MA R F K++IR L SV +GEF TRS KPI+DAST PL+ S + R YH Sbjct: 1 MAFRSFSNKFKIRDLGSVIVGEF--TRSRKPIKDASTSMPLVAVSESNWFKTASWLRHYH 58 Query: 241 DGRPRG 258 DGRPRG Sbjct: 59 DGRPRG 64 >XP_006591821.1 PREDICTED: uncharacterized protein LOC100306428 isoform X1 [Glycine max] KHN25233.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH24725.1 hypothetical protein GLYMA_12G058700 [Glycine max] KRH24726.1 hypothetical protein GLYMA_12G058700 [Glycine max] KRH24727.1 hypothetical protein GLYMA_12G058700 [Glycine max] Length = 255 Score = 52.0 bits (123), Expect = 7e-06 Identities = 33/66 (50%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Frame = +1 Query: 70 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIR---DASTPLMPSRPFQCRRLWGFREYH 240 MASR F K + R LAS+ L EF TRSSKPI+ S+P + F+ FR+YH Sbjct: 1 MASRSFFKNLKNRDLASLLLVEF--TRSSKPIKHISSTSSPFVECNSFKTASC--FRQYH 56 Query: 241 DGRPRG 258 DGRPRG Sbjct: 57 DGRPRG 62