BLASTX nr result
ID: Glycyrrhiza30_contig00026743
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00026743 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFF14592.1 Integrase core domain-containing protein [Methylobact... 94 2e-22 WP_056482761.1 integrase [Methylobacterium sp. Leaf117] KQP92279... 57 3e-08 WP_055952732.1 integrase [Methylobacterium sp. Leaf125] KQQ40876... 59 5e-08 WP_056282515.1 integrase [Methylobacterium sp. Leaf108] KQP56320... 59 5e-08 WP_056253703.1 integrase [Methylobacterium sp. Leaf93] KQP08413.... 59 5e-08 WP_056350800.1 MULTISPECIES: integrase [Methylobacterium] KQO692... 59 5e-08 WP_056144691.1 MULTISPECIES: integrase [Methylobacterium] KQO519... 59 5e-08 WP_018042840.1 hypothetical protein [Methylobacterium sp. 88A] 59 5e-08 WP_003596030.1 integrase [Methylobacterium extorquens] EHP95062.... 59 5e-08 WP_076611539.1 IS3 family transposase ISMex16 [Methylobacterium ... 59 6e-08 WP_056488705.1 integrase [Methylobacterium sp. Leaf117] KQP77536... 57 2e-07 WP_050735686.1 integrase [Methylobacterium sp. ARG-1] KNY20016.1... 57 2e-07 SFT22777.1 Integrase core domain-containing protein [Methylobact... 52 1e-06 SEP26968.1 Integrase core domain-containing protein [Methylobact... 52 1e-06 WP_056423746.1 integrase [Methylobacterium sp. Leaf91] KQP00316.... 52 2e-06 SFV16041.1 Integrase core domain-containing protein, partial [Me... 50 3e-06 SFU46771.1 Integrase core domain-containing protein, partial [Me... 50 4e-06 WP_055954444.1 hypothetical protein [Methylobacterium sp. Leaf12... 51 4e-06 SFV12926.1 Integrase core domain-containing protein, partial [Me... 50 4e-06 SFV15574.1 Integrase core domain-containing protein, partial [Me... 50 4e-06 >SFF14592.1 Integrase core domain-containing protein [Methylobacterium sp. 13MFTsu3.1M2] Length = 164 Score = 94.0 bits (232), Expect = 2e-22 Identities = 46/56 (82%), Positives = 48/56 (85%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA*PLNPDGPEPPFLSSPSRLKSSDDGHAA 280 GE IL E RIKRQTLMDRRLRHHAQAA PLNP GPEPPFLS P+RLKSSD+GH A Sbjct: 72 GEAILREWARIKRQTLMDRRLRHHAQAAQPLNPGGPEPPFLSVPNRLKSSDNGHQA 127 Score = 51.2 bits (121), Expect = 8e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -2 Query: 116 RRLRHHAQAA*PLTPDGPEPPLLNTAECPKSSDDG 12 RRLRHHAQAA PL P GPEPP L+ KSSD+G Sbjct: 90 RRLRHHAQAAQPLNPGGPEPPFLSVPNRLKSSDNG 124 >WP_056482761.1 integrase [Methylobacterium sp. Leaf117] KQP92279.1 integrase [Methylobacterium sp. Leaf117] Length = 130 Score = 57.0 bits (136), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQ A Sbjct: 103 GEGILAERERIKRQTLMDRRLRHHAQVA 130 >WP_055952732.1 integrase [Methylobacterium sp. Leaf125] KQQ40876.1 integrase [Methylobacterium sp. Leaf125] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_056282515.1 integrase [Methylobacterium sp. Leaf108] KQP56320.1 integrase [Methylobacterium sp. Leaf108] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_056253703.1 integrase [Methylobacterium sp. Leaf93] KQP08413.1 integrase [Methylobacterium sp. Leaf93] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_056350800.1 MULTISPECIES: integrase [Methylobacterium] KQO69209.1 integrase [Methylobacterium sp. Leaf89] KQP67542.1 integrase [Methylobacterium sp. Leaf111] KQT85002.1 integrase [Methylobacterium sp. Leaf465] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_056144691.1 MULTISPECIES: integrase [Methylobacterium] KQO51976.1 integrase [Methylobacterium sp. Leaf85] KQP40341.1 integrase [Methylobacterium sp. Leaf106] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_018042840.1 hypothetical protein [Methylobacterium sp. 88A] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_003596030.1 integrase [Methylobacterium extorquens] EHP95062.1 Integrase catalytic region [Methylobacterium extorquens DSM 13060] Length = 326 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMDRRLRHHAQAA 326 >WP_076611539.1 IS3 family transposase ISMex16 [Methylobacterium extorquens] Length = 450 Score = 58.5 bits (140), Expect = 6e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLMDRRLRHHAQAA Sbjct: 423 GEGILAERERIKRQTLMDRRLRHHAQAA 450 >WP_056488705.1 integrase [Methylobacterium sp. Leaf117] KQP77536.1 integrase [Methylobacterium sp. Leaf117] Length = 326 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAERERIKRQTLM+RRLRHHAQAA Sbjct: 299 GEGILAERERIKRQTLMERRLRHHAQAA 326 >WP_050735686.1 integrase [Methylobacterium sp. ARG-1] KNY20016.1 integrase [Methylobacterium sp. ARG-1] Length = 326 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILA+RERIKRQTLMDRRLRHHAQAA Sbjct: 299 GEGILAKRERIKRQTLMDRRLRHHAQAA 326 >SFT22777.1 Integrase core domain-containing protein [Methylobacterium sp. yr668] Length = 99 Score = 52.0 bits (123), Expect = 1e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GE IL ER RIKRQTLMDRRLRHHAQAA Sbjct: 72 GEAILQERARIKRQTLMDRRLRHHAQAA 99 >SEP26968.1 Integrase core domain-containing protein [Methylobacterium sp. UNC300MFChir4.1] Length = 99 Score = 52.0 bits (123), Expect = 1e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GE IL ER RIKRQTLMDRRLRHHAQAA Sbjct: 72 GEAILQERARIKRQTLMDRRLRHHAQAA 99 >WP_056423746.1 integrase [Methylobacterium sp. Leaf91] KQP00316.1 integrase [Methylobacterium sp. Leaf91] Length = 121 Score = 52.0 bits (123), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GEGILAER+RIKRQTLMDRRL H AQAA Sbjct: 94 GEGILAERKRIKRQTLMDRRLHHQAQAA 121 >SFV16041.1 Integrase core domain-containing protein, partial [Methylobacterium sp. UNCCL125] Length = 74 Score = 50.4 bits (119), Expect = 3e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GE IL ER +IKRQTLMDRRLRHHAQAA Sbjct: 47 GEAILRERAQIKRQTLMDRRLRHHAQAA 74 >SFU46771.1 Integrase core domain-containing protein, partial [Methylobacterium sp. UNCCL125] Length = 85 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GE IL ER +IKRQTLMDRRLRHHAQAA Sbjct: 58 GEAILRERAQIKRQTLMDRRLRHHAQAA 85 >WP_055954444.1 hypothetical protein [Methylobacterium sp. Leaf125] KQQ39050.1 hypothetical protein ASF58_23200 [Methylobacterium sp. Leaf125] Length = 101 Score = 50.8 bits (120), Expect = 4e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +2 Query: 8 VVRRQMIWDIQRCSGAEALVHLG 76 +VRRQMIWDIQRCSGAEALVHLG Sbjct: 79 IVRRQMIWDIQRCSGAEALVHLG 101 >SFV12926.1 Integrase core domain-containing protein, partial [Methylobacterium sp. UNCCL125] Length = 89 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GE IL ER +IKRQTLMDRRLRHHAQAA Sbjct: 62 GEAILRERAQIKRQTLMDRRLRHHAQAA 89 >SFV15574.1 Integrase core domain-containing protein, partial [Methylobacterium sp. UNCCL125] Length = 90 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 113 GEGILAERERIKRQTLMDRRLRHHAQAA 196 GE IL ER +IKRQTLMDRRLRHHAQAA Sbjct: 63 GEAILRERAQIKRQTLMDRRLRHHAQAA 90