BLASTX nr result
ID: Glycyrrhiza30_contig00026725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00026725 (406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004497054.1 PREDICTED: reticulon-like protein B14 [Cicer arie... 60 2e-08 XP_014513097.1 PREDICTED: reticulon-like protein B14 [Vigna radi... 60 3e-08 XP_017414185.1 PREDICTED: reticulon-like protein B14 [Vigna angu... 60 3e-08 XP_007142958.1 hypothetical protein PHAVU_007G031700g [Phaseolus... 59 4e-08 KHN42433.1 Reticulon-like protein B9 [Glycine soja] 54 3e-06 >XP_004497054.1 PREDICTED: reticulon-like protein B14 [Cicer arietinum] Length = 214 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 291 MPTRSHQPAQSYSPGFFGRQRQLHALLGGGKIADILLW 404 MPTRS++ QS +P FGRQR LHA+LGGGK+ADILLW Sbjct: 1 MPTRSNEFLQSSTPALFGRQRTLHAILGGGKLADILLW 38 >XP_014513097.1 PREDICTED: reticulon-like protein B14 [Vigna radiata var. radiata] Length = 212 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 291 MPTRSHQPAQSYSPGFFGRQRQLHALLGGGKIADILLW 404 MP RS +PAQ PGFF RQR LHALLGGGK+ADILLW Sbjct: 1 MPIRSREPAQR--PGFFHRQRPLHALLGGGKLADILLW 36 >XP_017414185.1 PREDICTED: reticulon-like protein B14 [Vigna angularis] KOM36291.1 hypothetical protein LR48_Vigan02g244100 [Vigna angularis] BAT93805.1 hypothetical protein VIGAN_08034200 [Vigna angularis var. angularis] Length = 212 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 291 MPTRSHQPAQSYSPGFFGRQRQLHALLGGGKIADILLW 404 MP RS +PAQ PGFF RQR LHALLGGGK+ADILLW Sbjct: 1 MPIRSREPAQR--PGFFHRQRPLHALLGGGKLADILLW 36 >XP_007142958.1 hypothetical protein PHAVU_007G031700g [Phaseolus vulgaris] ESW14952.1 hypothetical protein PHAVU_007G031700g [Phaseolus vulgaris] Length = 212 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 291 MPTRSHQPAQSYSPGFFGRQRQLHALLGGGKIADILLW 404 MP RS +PAQ PGFF RQR LHA+LGGGK+ADILLW Sbjct: 1 MPIRSREPAQR--PGFFNRQRPLHAVLGGGKLADILLW 36 >KHN42433.1 Reticulon-like protein B9 [Glycine soja] Length = 212 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +3 Query: 291 MPTRSHQPAQSYSPGFFGRQRQLHALLGGGKIADILLW 404 MP RS +PAQ PG RQR LHA+LGGGK+ADILLW Sbjct: 1 MPIRSREPAQR--PGLLDRQRPLHAVLGGGKLADILLW 36