BLASTX nr result
ID: Glycyrrhiza30_contig00026181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00026181 (212 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23004.1 hypothetical protein TSUD_297490 [Trifolium subterran... 101 1e-23 XP_012567873.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 2e-22 XP_003619926.2 pentatricopeptide (PPR) repeat protein [Medicago ... 87 2e-18 XP_007152635.1 hypothetical protein PHAVU_004G146500g, partial [... 82 9e-17 XP_017439919.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 5e-15 KOM54518.1 hypothetical protein LR48_Vigan10g041000 [Vigna angul... 77 5e-15 XP_017439911.1 PREDICTED: putative pentatricopeptide repeat-cont... 77 5e-15 KHN42860.1 Putative pentatricopeptide repeat-containing protein,... 77 9e-15 XP_014517211.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 1e-14 XP_014517187.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 1e-14 OIW16061.1 hypothetical protein TanjilG_04596 [Lupinus angustifo... 74 8e-14 XP_019436757.1 PREDICTED: putative pentatricopeptide repeat-cont... 74 8e-14 XP_007142061.1 hypothetical protein PHAVU_008G249200g [Phaseolus... 73 2e-13 XP_007142060.1 hypothetical protein PHAVU_008G249200g [Phaseolus... 73 2e-13 XP_004512723.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-12 XP_017429654.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 2e-12 BAT81387.1 hypothetical protein VIGAN_03109700 [Vigna angularis ... 70 2e-12 KYP48322.1 hypothetical protein KK1_030014 [Cajanus cajan] 70 2e-12 KOM47179.1 hypothetical protein LR48_Vigan07g088300 [Vigna angul... 70 2e-12 XP_016162116.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-12 >GAU23004.1 hypothetical protein TSUD_297490 [Trifolium subterraneum] Length = 524 Score = 101 bits (252), Expect = 1e-23 Identities = 50/70 (71%), Positives = 56/70 (80%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 R G VNEACD Y EMV N V PN +TYGSLIRGLCGVG+V E GLLDEMV EG+YVSV Sbjct: 93 RNGFVNEACDFYIEMVE-NGVCPNEFTYGSLIRGLCGVGRVWEGFGLLDEMVWEGLYVSV 151 Query: 181 HIFTVLIDSL 210 H+FT+LI+ L Sbjct: 152 HVFTILINGL 161 >XP_012567873.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Cicer arietinum] XP_012567874.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Cicer arietinum] XP_012567875.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Cicer arietinum] Length = 634 Score = 98.6 bits (244), Expect = 2e-22 Identities = 47/70 (67%), Positives = 57/70 (81%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 R G VNE CDL++EMV V PN +TYGSLIRGLCG+G+V EA G LDEM++EG+YVSV Sbjct: 202 RNGFVNEGCDLFNEMVGYG-VLPNEFTYGSLIRGLCGLGRVGEAFGFLDEMIKEGLYVSV 260 Query: 181 HIFTVLIDSL 210 ++FTVLID L Sbjct: 261 YVFTVLIDRL 270 >XP_003619926.2 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES76144.2 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 633 Score = 87.4 bits (215), Expect = 2e-18 Identities = 43/70 (61%), Positives = 53/70 (75%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 R G V+E + Y+EM+ N V PN +TYGSLIRGLCGVGK E GL+DEM+R G+ VSV Sbjct: 202 RNGFVDEGFEFYNEMMG-NGVCPNEFTYGSLIRGLCGVGKFLEGFGLVDEMIRRGLDVSV 260 Query: 181 HIFTVLIDSL 210 ++FTVLID L Sbjct: 261 YVFTVLIDGL 270 >XP_007152635.1 hypothetical protein PHAVU_004G146500g, partial [Phaseolus vulgaris] ESW24629.1 hypothetical protein PHAVU_004G146500g, partial [Phaseolus vulgaris] Length = 591 Score = 82.4 bits (202), Expect = 9e-17 Identities = 36/70 (51%), Positives = 56/70 (80%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +E LVNEAC+ Y+EMV N+V PN +TY L+R LC G+++EA+G+++ MV +G+Y+ V Sbjct: 163 KEELVNEACEWYYEMVA-NNVEPNVFTYRPLVRALCVAGRLDEAIGMVEGMVWKGVYIDV 221 Query: 181 HIFTVLIDSL 210 ++F+VLID+L Sbjct: 222 YVFSVLIDAL 231 >XP_017439919.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Vigna angularis] Length = 491 Score = 77.4 bits (189), Expect = 5e-15 Identities = 33/70 (47%), Positives = 55/70 (78%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EGLVNEAC+ +EMV N+V PN +TY L+R LC G+++EA+ +++ M+ +G+Y+ + Sbjct: 188 KEGLVNEACEWCYEMVG-NNVEPNVFTYRPLVRALCVAGRLDEAVRMVEGMITKGVYIDI 246 Query: 181 HIFTVLIDSL 210 ++F+VLID+L Sbjct: 247 YVFSVLIDAL 256 >KOM54518.1 hypothetical protein LR48_Vigan10g041000 [Vigna angularis] Length = 605 Score = 77.4 bits (189), Expect = 5e-15 Identities = 33/70 (47%), Positives = 55/70 (78%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EGLVNEAC+ +EMV N+V PN +TY L+R LC G+++EA+ +++ M+ +G+Y+ + Sbjct: 177 KEGLVNEACEWCYEMVG-NNVEPNVFTYRPLVRALCVAGRLDEAVRMVEGMITKGVYIDI 235 Query: 181 HIFTVLIDSL 210 ++F+VLID+L Sbjct: 236 YVFSVLIDAL 245 >XP_017439911.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439913.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439914.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439915.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439916.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439917.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] XP_017439918.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna angularis] BAU02648.1 hypothetical protein VIGAN_11220500 [Vigna angularis var. angularis] Length = 616 Score = 77.4 bits (189), Expect = 5e-15 Identities = 33/70 (47%), Positives = 55/70 (78%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EGLVNEAC+ +EMV N+V PN +TY L+R LC G+++EA+ +++ M+ +G+Y+ + Sbjct: 188 KEGLVNEACEWCYEMVG-NNVEPNVFTYRPLVRALCVAGRLDEAVRMVEGMITKGVYIDI 246 Query: 181 HIFTVLIDSL 210 ++F+VLID+L Sbjct: 247 YVFSVLIDAL 256 >KHN42860.1 Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 706 Score = 76.6 bits (187), Expect = 9e-15 Identities = 35/70 (50%), Positives = 53/70 (75%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EGLVNEAC+ Y+EMV N+V P +T+ L+R LC G + EA+ +++EM+ +GIYV + Sbjct: 59 KEGLVNEACEWYYEMVG-NNVEPTVFTFRPLVRALCVAGWLNEAVWMVEEMISKGIYVDL 117 Query: 181 HIFTVLIDSL 210 ++F+VLID L Sbjct: 118 YVFSVLIDGL 127 >XP_014517211.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Vigna radiata var. radiata] Length = 483 Score = 76.3 bits (186), Expect = 1e-14 Identities = 33/69 (47%), Positives = 54/69 (78%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EGLVNEAC+ ++EMV N+V PN +TY L+R LC G++ EA+ +++ M R+G+Y+ + Sbjct: 177 KEGLVNEACEWHYEMVG-NNVEPNVFTYRPLVRALCIAGRLNEAVRMVEGMDRKGVYIDI 235 Query: 181 HIFTVLIDS 207 ++F+VLID+ Sbjct: 236 YVFSVLIDA 244 >XP_014517187.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna radiata var. radiata] XP_014517191.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna radiata var. radiata] XP_014517196.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna radiata var. radiata] XP_014517201.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna radiata var. radiata] XP_014517205.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Vigna radiata var. radiata] Length = 604 Score = 76.3 bits (186), Expect = 1e-14 Identities = 33/69 (47%), Positives = 54/69 (78%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EGLVNEAC+ ++EMV N+V PN +TY L+R LC G++ EA+ +++ M R+G+Y+ + Sbjct: 177 KEGLVNEACEWHYEMVG-NNVEPNVFTYRPLVRALCIAGRLNEAVRMVEGMDRKGVYIDI 235 Query: 181 HIFTVLIDS 207 ++F+VLID+ Sbjct: 236 YVFSVLIDA 244 >OIW16061.1 hypothetical protein TanjilG_04596 [Lupinus angustifolius] Length = 574 Score = 73.9 bits (180), Expect = 8e-14 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = +1 Query: 10 LVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSVHIF 189 L+NEA DLY EM+ VSP +TY SLIRG C G+++EA+ LLD+MV + I +V+IF Sbjct: 143 LINEAHDLYSEMIA-KGVSPTVFTYQSLIRGFCVAGQLKEAIQLLDQMVHKDIRPNVYIF 201 Query: 190 TVLIDSL 210 T+LID+L Sbjct: 202 TILIDAL 208 >XP_019436757.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Lupinus angustifolius] XP_019436758.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Lupinus angustifolius] XP_019436759.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Lupinus angustifolius] Length = 655 Score = 73.9 bits (180), Expect = 8e-14 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = +1 Query: 10 LVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSVHIF 189 L+NEA DLY EM+ VSP +TY SLIRG C G+++EA+ LLD+MV + I +V+IF Sbjct: 224 LINEAHDLYSEMIA-KGVSPTVFTYQSLIRGFCVAGQLKEAIQLLDQMVHKDIRPNVYIF 282 Query: 190 TVLIDSL 210 T+LID+L Sbjct: 283 TILIDAL 289 >XP_007142061.1 hypothetical protein PHAVU_008G249200g [Phaseolus vulgaris] ESW14055.1 hypothetical protein PHAVU_008G249200g [Phaseolus vulgaris] Length = 437 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/70 (51%), Positives = 52/70 (74%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++ LVNEACDLY EMVV +SP+ TY SLI G C VG++ +A+GLL+EMV + I + Sbjct: 102 KDNLVNEACDLYSEMVV-KGISPDVVTYTSLIYGFCIVGQLIKAIGLLNEMVLKNIKPDI 160 Query: 181 HIFTVLIDSL 210 + +++LID+L Sbjct: 161 YTYSILIDAL 170 >XP_007142060.1 hypothetical protein PHAVU_008G249200g [Phaseolus vulgaris] ESW14054.1 hypothetical protein PHAVU_008G249200g [Phaseolus vulgaris] Length = 555 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/70 (51%), Positives = 52/70 (74%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++ LVNEACDLY EMVV +SP+ TY SLI G C VG++ +A+GLL+EMV + I + Sbjct: 220 KDNLVNEACDLYSEMVV-KGISPDVVTYTSLIYGFCIVGQLIKAIGLLNEMVLKNIKPDI 278 Query: 181 HIFTVLIDSL 210 + +++LID+L Sbjct: 279 YTYSILIDAL 288 >XP_004512723.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] XP_012574713.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] Length = 547 Score = 70.9 bits (172), Expect = 1e-12 Identities = 35/70 (50%), Positives = 49/70 (70%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++ LVN+A DLY EM+V +SPN TY SLI G C VG+++EA+GL +EM+ E I V Sbjct: 212 KDKLVNDAYDLYSEMIV-KKISPNVVTYSSLIYGFCIVGQLKEAVGLFNEMMLENINPDV 270 Query: 181 HIFTVLIDSL 210 + F +L+D L Sbjct: 271 YTFNILVDGL 280 >XP_017429654.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Vigna angularis] Length = 437 Score = 70.1 bits (170), Expect = 2e-12 Identities = 34/70 (48%), Positives = 50/70 (71%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++ LV EACDLY EMVV +SP+ TY SLI G C VG++ +A+GL +EMV + I + Sbjct: 102 KDSLVTEACDLYSEMVV-KGISPDVVTYTSLICGFCTVGQLNKAIGLFNEMVLKSIDPDI 160 Query: 181 HIFTVLIDSL 210 + +++LID+L Sbjct: 161 YTYSILIDAL 170 >BAT81387.1 hypothetical protein VIGAN_03109700 [Vigna angularis var. angularis] Length = 462 Score = 70.1 bits (170), Expect = 2e-12 Identities = 34/70 (48%), Positives = 50/70 (71%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++ LV EACDLY EMVV +SP+ TY SLI G C VG++ +A+GL +EMV + I + Sbjct: 127 KDSLVTEACDLYSEMVV-KGISPDVVTYTSLICGFCTVGQLNKAIGLFNEMVLKSIDPDI 185 Query: 181 HIFTVLIDSL 210 + +++LID+L Sbjct: 186 YTYSILIDAL 195 >KYP48322.1 hypothetical protein KK1_030014 [Cajanus cajan] Length = 490 Score = 70.1 bits (170), Expect = 2e-12 Identities = 32/70 (45%), Positives = 49/70 (70%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 +EG ++EAC+LY EM+ N V PN +TY L+R C G+V EA+ + +EM+ G+ V Sbjct: 58 KEGFLDEACELYREMIR-NHVVPNVFTYRPLVRAFCVAGRVHEAVCMAEEMLLNGVGVDA 116 Query: 181 HIFTVLIDSL 210 ++F+VLID+L Sbjct: 117 YVFSVLIDAL 126 >KOM47179.1 hypothetical protein LR48_Vigan07g088300 [Vigna angularis] Length = 497 Score = 70.1 bits (170), Expect = 2e-12 Identities = 34/70 (48%), Positives = 50/70 (71%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++ LV EACDLY EMVV +SP+ TY SLI G C VG++ +A+GL +EMV + I + Sbjct: 162 KDSLVTEACDLYSEMVV-KGISPDVVTYTSLICGFCTVGQLNKAIGLFNEMVLKSIDPDI 220 Query: 181 HIFTVLIDSL 210 + +++LID+L Sbjct: 221 YTYSILIDAL 230 >XP_016162116.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] XP_016162117.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] XP_016162118.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 592 Score = 70.1 bits (170), Expect = 2e-12 Identities = 37/70 (52%), Positives = 50/70 (71%) Frame = +1 Query: 1 REGLVNEACDLYHEMVVVNSVSPNAYTYGSLIRGLCGVGKVEEALGLLDEMVREGIYVSV 180 ++GLVNEA DLY EM+V VSPN +TY L+ LC VG+V EA+ L EMV +G+ V Sbjct: 162 KDGLVNEARDLYLEMIV-RGVSPNLFTYRPLVCKLCVVGQVNEAVWWLKEMVLKGVVPDV 220 Query: 181 HIFTVLIDSL 210 ++ T+LID+L Sbjct: 221 YVCTILIDAL 230