BLASTX nr result
ID: Glycyrrhiza30_contig00025751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025751 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO63124.1 Adenylosuccinate synthetase [Corchorus capsularis] 50 5e-06 OMO70263.1 Adenylosuccinate synthetase [Corchorus olitorius] 50 5e-06 XP_007162248.1 hypothetical protein PHAVU_001G136400g [Phaseolus... 50 7e-06 >OMO63124.1 Adenylosuccinate synthetase [Corchorus capsularis] Length = 492 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 26/77 (33%) Frame = +2 Query: 80 KLKNKKRYM-KFEIFIADTVHVMNEAIAEKK-ILIE------------------------ 181 +++N KRY + E FIADTVHVMNE+I++KK IL+E Sbjct: 253 EVENYKRYAERLEPFIADTVHVMNESISQKKRILVEGGQATMLDIDFGTYPFVTSSSPSA 312 Query: 182 GGICTGPGVNLRVIGNL 232 GGICTG G+ RV+G+L Sbjct: 313 GGICTGLGIAPRVVGDL 329 Score = 26.9 bits (58), Expect(2) = 5e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 HMDTSPQKPDLLLS 44 HMDT PQK DLLLS Sbjct: 221 HMDTFPQKLDLLLS 234 >OMO70263.1 Adenylosuccinate synthetase [Corchorus olitorius] Length = 491 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 26/77 (33%) Frame = +2 Query: 80 KLKNKKRYM-KFEIFIADTVHVMNEAIAEKK-ILIE------------------------ 181 +++N KRY + E FIADTVHVMNE+I++KK IL+E Sbjct: 252 EVENYKRYAERLEPFIADTVHVMNESISQKKRILVEGGQATMLDIDFGTYPFVTSSSPSA 311 Query: 182 GGICTGPGVNLRVIGNL 232 GGICTG G+ RV+G+L Sbjct: 312 GGICTGLGIAPRVVGDL 328 Score = 26.9 bits (58), Expect(2) = 5e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 HMDTSPQKPDLLLS 44 HMDT PQK DLLLS Sbjct: 220 HMDTFPQKLDLLLS 233 >XP_007162248.1 hypothetical protein PHAVU_001G136400g [Phaseolus vulgaris] ESW34242.1 hypothetical protein PHAVU_001G136400g [Phaseolus vulgaris] Length = 485 Score = 50.1 bits (118), Expect(2) = 7e-06 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 26/79 (32%) Frame = +2 Query: 74 RIKLKNKKRYM-KFEIFIADTVHVMNEAIAEK-KILIE---------------------- 181 R +++ KRY + E FIADTVHVMNEAI +K KIL+E Sbjct: 244 REEVEKYKRYAERLEPFIADTVHVMNEAITQKRKILVEGGQATMLDIDFGTYPFVTSSSP 303 Query: 182 --GGICTGPGVNLRVIGNL 232 GGICTG G+ RVIG+L Sbjct: 304 SAGGICTGLGIAPRVIGDL 322 Score = 26.9 bits (58), Expect(2) = 7e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 3 HMDTSPQKPDLLLSKKGL 56 HMDT PQK DL+LS L Sbjct: 214 HMDTFPQKLDLILSDAAL 231